Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0285135 (DDB_G0285135)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0285135; Putative uncharacterized protein DDB_G0285135
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0285135
Target Protein Sequence
MIINNQNSPQSINTPSSVSSRQHINKSKKKKENVIKRMLIRLSNSNNRSLATVFGVIGGL VLGIVLVCKEYENFPLVGKGLPLVYRIVGIFLSAGTGGNLSSYIGGTIDIITGDKTVVDL YKSFKRYFKKVKDKNHRSPIPLTNLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN SGGSGSTDNNNNNNEPIFSNNNSNNNNDNNSDLEIPIPI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DDB_G0285135 and why is it of interest to researchers?

DDB_G0285135 is a putative uncharacterized protein from Dictyostelium discoideum with 219 amino acids. While its specific function remains to be fully elucidated, it represents one of the numerous proteins in D. discoideum that may have orthologs in higher organisms including humans. Research interest stems from D. discoideum's position as one of eight non-mammalian model organisms recognized by the NIH for studying human pathology . The protein may be involved in cellular signaling pathways common to both D. discoideum and higher eukaryotes, making it valuable for comparative genomics studies.

What are the basic structural characteristics of DDB_G0285135?

Based on available information, DDB_G0285135 is a full-length protein containing 219 amino acids . While detailed structural analyses are still emerging, computational predictions suggest it may contain conserved domains common to signaling proteins in the D. discoideum proteome. The protein is likely membrane-associated or involved in cellular processes that are evolutionarily conserved, given the high percentage of D. discoideum proteins that share orthology with human proteins (approximately 22% - a figure comparable to D. melanogaster and C. elegans) .

How does Dictyostelium discoideum serve as a model organism for studying proteins like DDB_G0285135?

Dictyostelium discoideum offers several advantages as a model system for studying proteins like DDB_G0285135:

  • Experimental tractability with both traditional and molecular genetics, including targeted gene disruption techniques

  • Biochemical studies facilitated by the ability to grow cells in large amounts

  • A relatively simple genome (12,500 protein-coding genes) compared to humans, with limited alternative splicing

  • Available developmental transcription profiles for more than half of its genes

  • Haploid genome enabling direct phenotypic analysis of mutations

  • Unique developmental cycle with both unicellular and multicellular stages

This combination of features makes D. discoideum valuable for characterizing novel proteins and their functions, especially those that may have human counterparts involved in disease processes.

What expression systems are most effective for recombinant production of DDB_G0285135?

For recombinant expression of D. discoideum proteins like DDB_G0285135, several systems can be employed:

  • E. coli expression system: Most commonly used for initial characterization, as evidenced by the commercial availability of His-tagged DDB_G0285135 expressed in E. coli . This system offers:

    • High protein yields

    • Rapid growth

    • Cost-effectiveness

    • Well-established purification protocols

  • Native D. discoideum expression system: Particularly valuable for proteins requiring specific post-translational modifications:

    • Allows for proper folding and modification in the native cellular environment

    • Enables studies of cellular localization and interaction partners

    • Employs established vectors for both constitutive and inducible expression

  • Other eukaryotic systems: For complex proteins requiring extensive post-translational modifications:

    • Insect cells (baculovirus)

    • Mammalian cells

    • Yeast systems

The choice depends on research goals - E. coli for structural studies and high yields, versus D. discoideum expression for functional studies where proper folding and modifications are critical .

What purification strategies yield the highest purity and activity for DDB_G0285135?

For recombinant DDB_G0285135, particularly with a His-tag as commercially available , the following purification strategy is recommended:

Purification StepMethodBuffer ConditionsExpected Results
Initial CaptureNi-NTA affinity chromatography50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole>80% purity
Secondary PurificationSize exclusion chromatography20 mM HEPES pH 7.5, 150 mM NaCl>95% purity, separation of aggregates
Optional PolishingIon exchange chromatography20 mM Tris-HCl pH 8.0, salt gradient 0-500 mM NaCl>98% purity
Tag RemovalTEV protease digestion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM DTTNative protein

Optimizing these conditions is crucial, as D. discoideum proteins can exhibit unique stability requirements compared to mammalian proteins. Adding protease inhibitors during early purification stages is recommended due to the high protease activity in D. discoideum lysates .

How can I establish a reliable expression system in Dictyostelium for DDB_G0285135 functional studies?

To establish a reliable expression system in Dictyostelium for DDB_G0285135 functional studies:

  • Vector selection:

    • For overexpression: pDXA vectors with actin15 promoter

    • For regulated expression: tetracycline-inducible system

    • For visualization: GFP fusion constructs, similar to approaches used for other D. discoideum proteins

  • Transformation protocol:

    • Electroporation of D. discoideum cells (Ax2 or Ax3 strains recommended)

    • Selection with appropriate antibiotics (G418 or Blasticidin)

    • Clonal isolation on bacterial lawns or in 96-well plates

  • Expression verification:

    • Western blotting with anti-tag antibodies or custom antibodies

    • Fluorescence microscopy for GFP-tagged constructs

    • RT-PCR for mRNA expression levels

  • Recommended controls:

    • Empty vector controls

    • Cells expressing known proteins with similar characteristics

    • Wild-type cells for baseline comparison

This approach mirrors successful expression strategies used for other D. discoideum proteins, including those used in mitochondrial targeting studies and γ-secretase component analyses .

What subcellular localization patterns would be expected for DDB_G0285135?

Determining the subcellular localization of DDB_G0285135 is crucial for understanding its function. Based on approaches used for other D. discoideum proteins:

  • Experimental approach:

    • Create GFP or other fluorescent protein fusions (N- and C-terminal)

    • Express in D. discoideum cells under appropriate promoters

    • Use confocal microscopy with appropriate co-staining for organelle markers

  • Potential localization patterns to investigate:

    • Mitochondrial localization: Using MitoTracker™ as demonstrated for dUTPase

    • Membrane association: Similar to presenilin proteins in D. discoideum

    • Endoplasmic reticulum: As observed with γ-secretase complex components

    • Nuclear localization: Requiring DAPI co-staining

    • Cytoskeletal association: Common for many D. discoideum proteins

  • Validation methods:

    • Subcellular fractionation and Western blotting

    • Immunogold electron microscopy for high-resolution localization

    • Comparison of localization patterns under different developmental stages

If the protein contains targeting sequences, such as those predicted by algorithms like MitoProt II, BaCelLo, or MitoFates (as used for dUTPase analysis ), these should be experimentally validated through truncation analyses.

How can I design knockout/knockdown experiments to investigate DDB_G0285135 function?

For functional characterization through gene disruption approaches:

  • Gene knockout strategies:

    • Homologous recombination with selection cassette

    • CRISPR-Cas9 genome editing

    • Restriction enzyme-mediated integration (REMI) mutagenesis

  • Design considerations:

    • Target appropriate regions of the gene to ensure complete loss of function

    • Include flanking regions of 1-2 kb for efficient recombination

    • Create multiple independent knockout clones for validation

    • Verify knockout by PCR, Southern blotting, and RT-PCR

  • Knockdown alternatives (if knockout is lethal):

    • RNAi approaches using hairpin constructs

    • Antisense RNA expression

    • Inducible knockout systems

  • Phenotypic analysis pipeline:

    • Growth rate in axenic medium and on bacterial lawns

    • Development on non-nutrient agar (timing, morphology)

    • Chemotaxis, phagocytosis, and macropinocytosis assays

    • Cell-substrate and cell-cell adhesion

    • Resistance to various stresses (oxidative, osmotic)

This systematic approach has proven successful for functional characterization of other D. discoideum proteins, including presenilin and γ-secretase components .

What approaches can identify potential interaction partners of DDB_G0285135?

To identify interaction partners of DDB_G0285135, consider these complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged DDB_G0285135 in D. discoideum

    • Perform pulldown experiments under varying buffer conditions

    • Analyze co-purifying proteins by mass spectrometry

    • Compare results to control pulldowns to identify specific interactors

  • Proximity-based labeling:

    • BioID or TurboID fusion proteins to biotinylate proximal proteins

    • APEX2 peroxidase fusion for proximity labeling

    • Analysis of labeled proteins by streptavidin pulldown and mass spectrometry

  • Yeast two-hybrid screening:

    • Using DDB_G0285135 as bait against D. discoideum cDNA library

    • Domain-specific interactions using truncated constructs

  • Co-immunoprecipitation validation:

    • Targeted verification of key interactions

    • Reciprocal co-IPs with tagged versions of interaction partners

    • Analysis under different developmental stages or stress conditions

These approaches mirror successful strategies used for protein-protein interaction studies in D. discoideum, such as those employed for γ-secretase complex analysis and mitochondrial protein characterization .

What are the most effective approaches for determining the three-dimensional structure of DDB_G0285135?

For structural determination of DDB_G0285135, consider these hierarchical approaches:

  • X-ray crystallography workflow:

    • High-yield expression (10-20 mg/L) in E. coli or insect cells

    • Multi-step purification to >95% homogeneity

    • Crystallization screening (vapor diffusion, microbatch)

    • Optimization of crystal growth conditions

    • Data collection at synchrotron radiation facilities

    • Structure solution by molecular replacement or experimental phasing

  • Cryo-electron microscopy:

    • Particularly valuable if the protein forms larger complexes

    • Sample preparation on holey carbon grids

    • Screening for optimal buffer conditions and vitrification parameters

    • Data collection on high-end electron microscopes

    • Image processing and 3D reconstruction

  • NMR spectroscopy (for smaller domains):

    • Isotopic labeling (¹⁵N, ¹³C, ²H) in E. coli

    • Sequential backbone assignment

    • Side chain assignment and NOE collection

    • Structure calculation and refinement

  • Integrative structural biology:

    • Combining lower-resolution techniques (SAXS, SANS, XL-MS)

    • Computational modeling and docking approaches

    • Molecular dynamics simulations for dynamic analysis

The successful structural characterization of the D. discoideum dUTPase core enzyme demonstrates the feasibility of these approaches for D. discoideum proteins.

How can post-translational modifications of DDB_G0285135 be characterized in detail?

To comprehensively characterize post-translational modifications (PTMs) of DDB_G0285135:

  • Mass spectrometry-based workflow:

    • Purify protein from native D. discoideum or recombinant sources

    • Enzymatic digestion (trypsin, chymotrypsin, Glu-C for overlapping coverage)

    • LC-MS/MS analysis using higher-energy collisional dissociation (HCD)

    • Electron transfer dissociation (ETD) for labile modifications

    • Database searching with variable modification parameters

  • Targeted PTM analyses:

    • Phosphorylation: Phospho-enrichment (TiO₂, IMAC) before MS analysis

    • Glycosylation: Lectin affinity enrichment, PNGase F treatment

    • Ubiquitination: Antibody enrichment of diGly-remnant peptides

    • Other modifications: Acetylation, methylation, SUMOylation

  • Site-directed mutagenesis validation:

    • Mutation of modified residues to non-modifiable equivalents

    • Functional consequences assessment

    • Changes in localization, stability, or interaction partners

  • Developmental and stimulus-dependent PTM mapping:

    • Compare modifications across D. discoideum developmental stages

    • Response to stressors or signaling activators

    • Correlation with protein function or localization changes

This approach is similar to successful PTM characterization strategies for other D. discoideum proteins, revealing key regulatory mechanisms .

What enzymatic activities should be tested for DDB_G0285135 based on its sequence features?

While DDB_G0285135 is currently annotated as a putative uncharacterized protein, systematic enzymatic activity screening should be based on:

  • Computational predictions:

    • Sequence homology with proteins of known function

    • Domain architecture predictions

    • Active site motif identification

    • Structural modeling to identify potential catalytic residues

  • General enzymatic activity screens:

    • Hydrolase activities (phosphatase, protease, nuclease)

    • Transferase activities (kinase, methyltransferase)

    • Redox activities (oxidoreductase)

    • Binding assays (nucleic acids, lipids, small molecules)

  • Context-based functional assays:

    • If localized to mitochondria: electron transport chain involvement

    • If nuclear: transcriptional regulation or DNA metabolism

    • If membrane-associated: transport or signaling activities

  • D. discoideum-specific considerations:

    • Involvement in developmental signaling pathways

    • Phagocytosis or macropinocytosis processes

    • Cell motility or chemotaxis mechanisms

The systematic characterization approach used for the D. discoideum kinome provides an excellent template for enzymatic characterization of uncharacterized proteins like DDB_G0285135.

How does DDB_G0285135 expression change during Dictyostelium development?

Understanding the expression profile of DDB_G0285135 throughout D. discoideum's developmental cycle is essential for functional insights:

  • Temporal expression analysis:

    • RNA isolation from cells at defined developmental time points (0, 5, 10, 15, 20, and 24 hours)

    • Northern blot hybridization or RT-qPCR analysis with gene-specific probes

    • RNA-seq for comprehensive transcriptome analysis

    • Western blotting to confirm protein-level changes

  • Spatial expression patterns:

    • In situ hybridization during multicellular development

    • Reporter gene constructs (lacZ or GFP) under the DDB_G0285135 promoter

    • Immunostaining of developing structures with antibodies

  • Expression patterns to compare against:

    • Constitutively expressed genes (like D. discoideum γ-secretase components ps1, nct, aph1, and pen2)

    • Developmentally regulated genes (like ps2, which shows upregulation at 10 hours)

    • Cell-type specific markers for prestalk and prespore cells

  • Regulation analysis:

    • Promoter dissection to identify regulatory elements

    • Transcription factor binding site identification

    • Epigenetic regulation through chromatin immunoprecipitation

This approach mirrors successful developmental expression analyses performed for D. discoideum proteins involved in γ-secretase function and other developmental processes.

What phenotypic assays are most informative for understanding DDB_G0285135 function in Dictyostelium?

For comprehensive phenotypic characterization of DDB_G0285135-disrupted or overexpressing cells:

  • Growth and development assays:

    • Growth rate in axenic medium and on bacterial lawns

    • Plaque formation on bacterial lawns

    • Development timing and morphology on non-nutrient agar

    • Cell-type proportioning during development

    • Spore viability and germination efficiency

  • Cell biological assays:

    • Phagocytosis rates using fluorescent beads or bacteria

    • Macropinocytosis using fluid-phase markers

    • Chemotaxis to cAMP or folate

    • Random motility and cell shape analysis

    • Cell-cell and cell-substrate adhesion

  • Stress response characterization:

    • Oxidative stress resistance (H₂O₂, paraquat)

    • Osmotic stress tolerance

    • Nutrient limitation responses

    • Temperature sensitivity

  • Molecular pathway analysis:

    • cAMP signaling cascade components

    • Calcium signaling

    • Phosphorylation patterns of key regulatory proteins

    • Gene expression changes in response to specific stimuli

This comprehensive phenotypic analysis approach has successfully revealed functions for presenilin proteins in D. discoideum, showing their roles in phagocytosis and cell-fate specification .

How can I investigate whether DDB_G0285135 has functional homologs in mammalian systems?

To identify and characterize potential mammalian homologs of DDB_G0285135:

  • Computational comparative genomics:

    • Sequence homology searches (BLAST, HMMER)

    • Domain architecture comparison

    • Phylogenetic analysis to identify orthology relationships

    • Synteny analysis for genomic context conservation

  • Functional complementation assays:

    • Express mammalian candidates in DDB_G0285135-knockout D. discoideum

    • Assess phenotypic rescue

    • Express DDB_G0285135 in mammalian cell lines with the homolog silenced

  • Interaction partner conservation:

    • Compare interaction networks between D. discoideum and mammalian cells

    • Test conservation of critical protein-protein interactions

    • Analyze conservation of regulatory mechanisms

  • Disease relevance assessment:

    • Correlate the mammalian homolog with disease states

    • Analyze genetic variations in patient populations

    • Utilize D. discoideum as a model for testing disease-associated variants

This approach leverages D. discoideum's value as a model organism for studying human disease-related genes, as demonstrated for presenilin/γ-secretase pathways relevant to Alzheimer's disease and various neurological disorders .

What are the key considerations when designing experiments to study DDB_G0285135?

When designing comprehensive research on DDB_G0285135, consider these methodological elements:

  • Research objectives and approach:

    • Define clear hypotheses based on preliminary data and bioinformatic predictions

    • Decide between qualitative or quantitative approaches depending on the research question

    • Consider mixed-methods designs for complex functional characterization

  • Experimental controls:

    • Include appropriate negative controls (empty vector, unrelated protein expression)

    • Positive controls (proteins with known functions similar to predictions)

    • Multiple independent clones for genetic manipulations

    • Technical and biological replicates for statistical validity

  • Data collection methods:

    • Select appropriate techniques based on the specific protein characteristics

    • Ensure methods have sufficient sensitivity and specificity

    • Consider temporal aspects (developmental stages, growth phases)

    • Implement quantitative measurements where possible

  • Data analysis strategies:

    • Select appropriate statistical methods for each data type

    • Consider computational approaches for large datasets

    • Integrate results from multiple methodologies

    • Address potential confounding variables

Following these design principles, as outlined in systematic research methodology guidelines , ensures rigorous characterization of previously uncharacterized proteins like DDB_G0285135.

How can I optimize recombinant antibody production for DDB_G0285135 research?

For developing effective recombinant antibodies against DDB_G0285135:

  • Antibody generation strategies:

    • Phage display selections against purified protein

    • Hybridoma development followed by antibody sequencing

    • Synthetic antibody libraries screening

    • Immunization of animals with specific peptides or full protein

  • Optimization considerations:

    • Epitope selection for accessibility in native protein

    • Antibody format selection (scFv, Fab, IgG)

    • Expression system optimization for yield and quality

    • Affinity maturation if needed for sensitivity

  • Validation requirements:

    • Western blotting against recombinant and endogenous protein

    • Immunoprecipitation efficiency testing

    • Immunofluorescence specificity

    • Comparison against knockout controls

    • Cross-reactivity assessment

  • Applications optimization:

    • Buffer conditions for long-term stability

    • Conjugation strategies for specific applications

    • Validation across multiple experimental conditions

This approach aligns with successful recombinant antibody development strategies for D. discoideum antigens, providing reliable reagents for protein labeling and characterization accessible to the research community .

What data management and analysis pipelines are recommended for multi-omics studies involving DDB_G0285135?

For comprehensive multi-omics investigation of DDB_G0285135:

  • Data collection planning:

    • Coordinate sample preparation across platforms

    • Include appropriate quality control samples

    • Ensure consistent experimental conditions

    • Plan for sufficient replication for statistical power

  • Integrated data analysis pipeline:

Omics LevelKey TechnologiesAnalysis ApproachesIntegration Points
GenomicsWhole genome sequencing, targeted sequencingVariant calling, structural analysisGenetic background context
TranscriptomicsRNA-seq, microarrayDifferential expression, co-expression networksExpression correlation with phenotypes
ProteomicsMS/MS, TMT labelingProtein identification, quantification, PTM mappingProtein-level validation of transcripts
InteractomicsAP-MS, Y2H, BioIDInteraction network analysis, complex identificationFunctional context for the protein
MetabolomicsLC-MS, GC-MSMetabolite changes, pathway enrichmentDownstream effects of protein function
PhenomicsMicroscopy, growth assaysQuantitative phenotypic analysisPhenotypic consequences of molecular changes
  • Computational integration approaches:

    • Network-based data integration

    • Machine learning for pattern recognition

    • Pathway enrichment across multiple data types

    • Visualization tools for multi-dimensional data

  • Validation strategies:

    • Targeted experiments to confirm key findings

    • Orthogonal technologies for critical results

    • Genetic manipulation to establish causality

    • Comparison with published datasets

This comprehensive approach mirrors successful multi-omics strategies used in model organism research, allowing for a systems-level understanding of DDB_G0285135 function.

How does DDB_G0285135 relate evolutionarily to proteins in other organisms?

To establish the evolutionary context of DDB_G0285135:

  • Phylogenetic analysis workflow:

    • Identify homologs through iterative sequence searches (PSI-BLAST, HMMer)

    • Perform multiple sequence alignment of homologs

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Assess evolutionary rates and selective pressures

  • Domain architecture analysis:

    • Identify conserved domains and motifs

    • Compare domain arrangements across species

    • Analyze conservation of critical residues

    • Identify lineage-specific insertions or deletions

  • Genomic context comparison:

    • Analyze synteny relationships across species

    • Identify co-evolving gene clusters

    • Examine intron-exon structure conservation

    • Assess regulatory region conservation

  • Functional innovation tracing:

    • Map functional changes to evolutionary events

    • Identify potential neofunctionalization or subfunctionalization

    • Correlate with organism complexity or niche adaptation

This evolutionary perspective provides context for understanding DDB_G0285135's potential functions, similar to analyses performed for the D. discoideum kinome that revealed both conserved and unique components compared to other organisms .

What can we learn from comparing DDB_G0285135 to similar proteins in the Dictyostelid lineage?

For deeper understanding through comparative analysis within Dictyostelids:

  • Intra-Dictyostelid comparison approach:

    • Identify orthologs in other Dictyostelium species (D. purpureum, D. fasciculatum, etc.)

    • Compare conservation patterns within the social amoeba clade

    • Analyze expression patterns across species

    • Assess functional conservation through complementation studies

  • Developmental role evolution:

    • Compare expression timing during development across species

    • Analyze conservation of regulatory elements

    • Assess role in species-specific developmental processes

    • Correlate with complexity of multicellular structures

  • Functional specialization assessment:

    • Identify species-specific adaptations in protein sequence or structure

    • Correlate with ecological niches of different Dictyostelids

    • Analyze convergent or divergent evolution patterns

    • Assess lineage-specific interaction partners

  • Conservation in core cellular processes:

    • Compare involvement in fundamental processes like phagocytosis

    • Assess conservation in stress response mechanisms

    • Analyze role in conserved signaling pathways

    • Evaluate conservation of post-translational modifications

This approach mirrors successful comparative analyses within the Dictyostelid lineage that have revealed both conserved cellular mechanisms and developmental innovations.

What are common pitfalls when working with recombinant DDB_G0285135 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant D. discoideum proteins like DDB_G0285135:

  • Expression yield issues:

    • Problem: Low protein expression in E. coli

    • Solution: Optimize codon usage, test different E. coli strains (BL21, Rosetta), lower induction temperature (16-20°C), use autoinduction media, or switch to eukaryotic expression systems

  • Protein solubility challenges:

    • Problem: Formation of inclusion bodies

    • Solution: Express as fusion with solubility tags (MBP, SUMO, TRX), optimize buffer conditions, use mild detergents for membrane-associated proteins, employ on-column refolding

  • Protein stability issues:

    • Problem: Rapid degradation during purification

    • Solution: Include protease inhibitor cocktails, perform purification at 4°C, optimize buffer conditions (pH, salt, additives), identify and mutate protease-sensitive sites

  • Activity loss:

    • Problem: Purified protein lacks expected activity

    • Solution: Ensure proper folding, verify cofactor requirements, test different buffer conditions, assess oligomerization state, evaluate post-translational modification requirements

  • Antibody specificity:

    • Problem: Poor recognition by antibodies

    • Solution: Use epitope tags for detection, generate multiple antibodies against different regions, validate antibodies using knockout controls

This troubleshooting guidance reflects common challenges encountered in work with D. discoideum proteins, particularly those requiring native conformations for activity .

How can I address genetic manipulation challenges in Dictyostelium when studying DDB_G0285135?

When manipulating DDB_G0285135 in D. discoideum, researchers may encounter these challenges:

  • Knockout generation difficulties:

    • Problem: Failure to obtain knockout clones

    • Solution: Verify targeting construct design, increase homology arm length, use CRISPR-Cas9 approach, consider conditional knockout if gene is essential, attempt knockdown strategies

  • Phenotype verification challenges:

    • Problem: Subtle or variable phenotypes

    • Solution: Increase biological replicates, standardize growth conditions, use quantitative assays, test under stress conditions that may amplify phenotypes, perform rescue experiments

  • Developmental timing issues:

    • Problem: Asynchronous development affecting analysis

    • Solution: Implement pulse synchronization techniques, analyze single cells rather than populations, use time-lapse imaging, employ developmental markers

  • Expression level challenges:

    • Problem: Toxicity of overexpression

    • Solution: Use inducible promoters, optimize expression level through promoter selection, create stable cell lines with moderate expression, use homologous recombination for endogenous tagging

  • Multi-copy integration concerns:

    • Problem: Variable expression due to random integration

    • Solution: Screen multiple clones, quantify copy number, use targeted integration approaches, implement single-cell analysis

These approaches reflect best practices established for genetic manipulation in D. discoideum, which has proven valuable for studying proteins involved in diverse cellular processes .

What strategies help resolve contradictory data when characterizing DDB_G0285135 function?

When facing contradictory results during DDB_G0285135 characterization:

  • Experimental design reassessment:

    • Review controls for adequacy

    • Ensure experimental conditions are truly comparable

    • Assess statistical power and significance

    • Evaluate reagent quality and specificity

  • Multi-approach validation:

    • Employ orthogonal techniques to address the same question

    • Vary experimental conditions systematically

    • Use independent genetic manipulations (different knockout strategies)

    • Test in different D. discoideum strains

  • Context-dependent function evaluation:

    • Assess developmental stage specificity

    • Test function under different growth conditions

    • Evaluate nutrient dependency of phenotypes

    • Consider cell density effects

  • Collaboration and independent verification:

    • Engage with other laboratories for verification

    • Blind analysis of critical data

    • Implement more rigorous statistical analysis

    • Consider pre-registration of key experiments

This systematic approach to resolving contradictory data reflects best practices in scientific rigor and reproducibility, particularly important for characterizing novel proteins like DDB_G0285135 where limited prior knowledge exists.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.