Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0286831 (DDB_G0286831)

Shipped with Ice Packs
In Stock

Description

Protein Overview

DDB_G0286831 is a hypothetical protein encoded by the DDB_G0286831 gene in D. discoideum. Its designation as "uncharacterized" reflects the absence of direct experimental evidence for its function. Key attributes include:

AttributeValue
UniProt IDQ54TN8
Sequence Length107 amino acids (full-length recombinant version)
Molecular Weight~12 kDa (estimated)
Expression HostE. coli (recombinant production)
TagN-terminal His-tag

Recombinant Expression and Purification

The recombinant DDB_G0286831 protein is produced in E. coli and purified to >90% purity via affinity chromatography. Structural and biochemical details include:

ParameterDescription
SequenceMMNFATRSVLRGSIKVNRLYTASASSSSSTRIPSGFASATSSKSNSSTKSSPSPINSFNNKTNNIFKSNATNNSSLAFGIVEFMVFNGMISTITTTTFNNNNNNNNK
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) for stability

The protein is lyophilized and stored at -20°C/-80°C to prevent degradation .

Inferred Biological Roles

While no direct functional studies exist, DDB_G0286831 is associated with pathways critical to cellular processes:

Pathway Involvement

PathwayDescription
DNA RepairLinked to base excision repair (BER) and single-strand break repair (SSBR)
DNA Damage BypassPotential role in translesion synthesis or replication stress responses
DNA ReplicationSuggested involvement in replication fork stability or restart mechanisms

These associations derive from genomic annotations and pathway databases (e.g., Reactome) .

Research Applications

DDB_G0286831 is primarily used in:

  1. Proteomic Studies: Serves as a control or reference in mass spectrometry-based analyses of D. discoideum proteins .

  2. Functional Screening: A candidate for high-throughput assays to probe uncharacterized protein functions.

  3. Model Organism Research: Leverages D. discoideum’s genetic tractability to study conserved eukaryotic processes .

Current Limitations

  • Functional Data Gap: No experimental validation of its roles in cellular processes.

  • Expression Context: Limited information on tissue-specific expression or developmental regulation.

  • Interactome: No reported protein-protein interactions or complex memberships .

Future Directions

  1. Functional Knockout Studies: Generate DDB_G0286831 deletion mutants in D. discoideum to assess phenotypic impacts.

  2. Biochemical Assays: Test enzymatic activity or binding specificity using purified recombinant protein.

  3. Evolutionary Analysis: Compare homologs across Dictyostelia to infer ancestral roles.

Table 2: Pathway Associations

PathwayComponents
DNA RepairAPEX1, FEN1, PCNA, POLD, POLE, RPA, RFC
DNA Damage BypassPOLK, RAD51, XRCC1, DNA ligase III

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0286831; Putative uncharacterized protein DDB_G0286831
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0286831
Target Protein Sequence
MMNFATRSVLRGSIKVNRLYTASASSSSSTRIPSGFASATSSKSNSSTKSSPSPINSFNN KTNNIFKSNATNNSSLAFGIVEFMVFNGMISTITTTTFNNNNNNNNK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining protein stability?

For optimal stability, the lyophilized DDB_G0286831 protein should be stored at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week. The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0. Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity .

For reconstitution:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (preferably 50%)

  • Aliquot for long-term storage at -20°C/-80°C

What expression system is used for recombinant DDB_G0286831 production?

The recombinant full-length DDB_G0286831 protein is expressed in E. coli with an N-terminal His tag. This prokaryotic expression system provides several advantages for this particular protein:

  • High yield of protein expression

  • Cost-effective production

  • Relatively simple purification process via His-tag affinity chromatography

  • Suitable for this small protein (107 amino acids) that likely does not require extensive post-translational modifications

What are the key methodological steps for working with DDB_G0286831 in protein interaction studies?

When designing protein interaction studies with DDB_G0286831, follow these methodological steps:

  • Protein preparation:

    • Reconstitute the lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 50% final concentration for stability

    • Maintain working aliquots at 4°C for no more than one week

  • Interaction assays:

    • For co-immunoprecipitation: Use anti-His antibodies for pull-down experiments

    • For SPR/BLI: Immobilize the His-tagged protein on Ni-NTA sensor chips

    • For crosslinking studies: Consider the high number of asparagine residues in the C-terminal region

  • Controls:

    • Include a non-His-tagged control protein of similar size

    • Use E. coli lysate expressing an empty vector as negative control

    • Consider testing interaction specificity with other Dictyostelium proteins

  • Analysis considerations:

    • Verify protein purity (>90% as determined by SDS-PAGE)

    • Account for potential interference from the His-tag in interaction studies

    • Consider the uncharacterized nature of the protein when interpreting results

How should researchers address challenges in experimental reproducibility when using this uncharacterized protein?

To enhance experimental reproducibility when working with DDB_G0286831:

  • Standardized reconstitution:

    • Always reconstitute from lyophilized form using identical buffer conditions

    • Maintain consistent protein concentration across experiments

    • Document lot numbers and storage history of protein samples

  • Quality control measures:

    • Verify protein integrity by SDS-PAGE before each experiment

    • Consider amino acid analysis to confirm concentration

    • Implement positive controls for functional assays

  • Experimental design considerations:

    • Use multiple technical and biological replicates

    • Blind sample analysis when possible

    • Maintain detailed laboratory records of all experimental parameters

    • Apply appropriate statistical methods for data analysis

  • Reporting practices:

    • Document complete methodological details including reconstitution procedure

    • Report protein lot numbers and manufacturer details

    • Share raw data and analysis workflows when publishing

What approaches are recommended for functional characterization of this uncharacterized protein?

For functional characterization of DDB_G0286831, a systematic multi-pronged approach is recommended:

  • Bioinformatic analysis:

    • Sequence homology searches across species

    • Secondary structure prediction

    • Identification of conserved domains and motifs

    • Prediction of post-translational modification sites

  • Structural studies:

    • Circular dichroism spectroscopy for secondary structure determination

    • NMR spectroscopy for solution structure (appropriate given the small size of 107 amino acids)

    • X-ray crystallography for high-resolution structure (if crystallizable)

    • AlphaFold2 or similar AI-based structure prediction

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening with Dictyostelium cDNA library

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID)

    • Co-immunoprecipitation with candidate interacting proteins

  • Localization studies:

    • Generate antibodies against purified DDB_G0286831

    • Fluorescent tagging and microscopy in Dictyostelium cells

    • Subcellular fractionation followed by western blotting

  • Functional assays:

    • Gene knockout/knockdown in Dictyostelium

    • Phenotypic analysis of mutant strains

    • Complementation studies with the recombinant protein

What are the predicted challenges in studying protein-protein interactions involving DDB_G0286831?

Several challenges may arise when investigating protein-protein interactions of DDB_G0286831:

  • Structural considerations:

    • The high asparagine content in the C-terminal region (multiple N repeats) may lead to aggregation

    • Potential intrinsically disordered regions could complicate interaction analysis

    • The small size (107 amino acids) may limit interaction surface area

  • Technical challenges:

    • The His-tag may interfere with native protein interactions

    • Non-specific binding to the His-tag in pull-down assays

    • Limited knowledge of physiological partners hampers validation

    • Possible low-affinity transient interactions could be missed in standard assays

  • Biological context:

    • Difficulty recreating the Dictyostelium cellular environment in vitro

    • Unknown post-translational modifications in the native protein

    • Potential requirement for specific cofactors or conditions for interactions

  • Validation strategies:

    • Perform reciprocal co-IP experiments

    • Use tag-free protein for validation

    • Implement multiple complementary interaction detection methods

    • Consider in vivo confirmation in Dictyostelium cells

What are the critical factors affecting the expression yield of DDB_G0286831 in E. coli systems?

Several factors can significantly impact the expression yield of DDB_G0286831 in E. coli:

  • Codon optimization:

    • Dictyostelium has a different codon usage bias than E. coli

    • Rare codons in the native sequence may reduce translation efficiency

    • Consider codon-optimized synthetic gene constructs for improved expression

  • Expression conditions:

    • Induction temperature (lower temperatures often improve soluble protein yield)

    • IPTG concentration for induction

    • Duration of induction

    • OD600 value at induction

    • Media composition (rich vs. minimal media)

  • Strain selection:

    • BL21(DE3) derivatives for T7-based expression

    • Rosetta strains to supply rare tRNAs

    • SHuffle strains for improved disulfide bond formation

    • Arctic Express for low-temperature expression

  • Fusion partners:

    • The N-terminal His-tag assists in purification but other fusion partners like:

      • SUMO or MBP can improve solubility

      • GST can enhance expression and facilitate purification

      • Thioredoxin can improve folding and solubility

How can researchers address potential solubility issues with the recombinant DDB_G0286831 protein?

To address solubility challenges that may arise with DDB_G0286831:

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use auto-induction media for gradual protein expression

  • Buffer optimization:

    • Screen different pH conditions (pH 6.0-9.0)

    • Test various salt concentrations (100-500 mM NaCl)

    • Add stabilizing agents (glycerol, trehalose, arginine, glutamic acid)

    • Include mild detergents for hydrophobic regions (0.05-0.1% Triton X-100)

  • Protein engineering approaches:

    • Remove or substitute the asparagine-rich C-terminal region

    • Design truncated constructs of functional domains

    • Introduce solubility-enhancing point mutations

    • Use larger solubility-enhancing fusion partners (MBP, GST)

  • Refolding strategies (if expressed in inclusion bodies):

    • Gradual dialysis from denaturing conditions

    • On-column refolding during purification

    • Pulse dilution refolding methods

    • Screen various redox conditions for optimal folding

What analytical techniques are most appropriate for assessing the structural integrity of purified DDB_G0286831?

For comprehensive structural characterization of DDB_G0286831:

How should researchers interpret conflicting results from different structural prediction tools for this uncharacterized protein?

When facing conflicting structural predictions for DDB_G0286831:

  • Systematic comparison approach:

    • Compile results from multiple prediction algorithms (JPred, PSIPRED, I-TASSER, etc.)

    • Identify regions of consensus and disagreement

    • Weight predictions based on algorithm performance for similar proteins

    • Consider predictions specifically trained on amoebozoan proteomes

  • Experimental validation strategy:

    • Prioritize experimental techniques to validate predictions

    • Use CD spectroscopy to determine secondary structure content

    • Apply limited proteolysis to identify domain boundaries

    • Consider hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Integrative modeling:

    • Combine computational predictions with experimental data

    • Use crosslinking mass spectrometry to provide distance constraints

    • Apply molecular dynamics simulations to test model stability

    • Consider the asparagine-rich C-terminal region as potentially disordered

  • Resolution strategy for conflicts:

    • Give higher weight to predictions consistent with experimental data

    • Consider that different regions may be predicted with different accuracy

    • Account for potential disorder in the asparagine-rich regions

    • Acknowledge limitations in the final structural model

What are the recommended approaches for investigating potential post-translational modifications of DDB_G0286831 in Dictyostelium?

To investigate post-translational modifications (PTMs) of DDB_G0286831:

  • Computational prediction:

    • Use PTM-specific prediction tools (NetPhos, NetGlycate, etc.)

    • Analyze conservation of potential modification sites

    • Identify consensus motifs for kinases, glycosyltransferases, etc.

    • Compare with known PTMs in related proteins

  • Mass spectrometry-based approaches:

    • Immunoprecipitate the native protein from Dictyostelium

    • Perform intact mass analysis to determine total modifications

    • Use enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Apply tandem MS for site-specific identification

  • Biochemical methods:

    • Phosphatase treatment to identify phosphorylated forms

    • Glycosidase digestion for glycosylation assessment

    • Western blotting with PTM-specific antibodies

    • Mobility shift assays to detect modified forms

  • Functional validation:

    • Generate site-directed mutants of predicted PTM sites

    • Perform functional complementation studies

    • Analyze phenotypic consequences of PTM site mutations

    • Study temporal dynamics of modifications during Dictyostelium development

How can researchers design experiments to elucidate the role of DDB_G0286831 in Dictyostelium development?

To investigate the role of DDB_G0286831 in Dictyostelium development:

  • Expression analysis:

    • Quantify mRNA levels at different developmental stages using RT-qPCR

    • Analyze protein expression using western blot with stages from vegetative growth to fruiting body formation

    • Perform in situ hybridization to determine spatial expression patterns

    • Use reporter constructs (GFP fusion) to track expression dynamics

  • Loss-of-function studies:

    • Generate knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create conditional knockdowns using inducible RNAi

    • Analyze developmental phenotypes (timing, morphology, cell sorting)

    • Perform transcriptome analysis to identify affected pathways

  • Gain-of-function approaches:

    • Overexpress the protein under constitutive promoters

    • Create stage-specific inducible expression systems

    • Analyze consequences on developmental timing and morphology

    • Perform cell autonomy studies using chimeric development

  • Localization studies:

    • Track protein localization throughout development using GFP fusion proteins

    • Perform immunostaining at different developmental stages

    • Analyze subcellular distribution changes during development

    • Identify co-localization with developmental markers

What methodological approaches should be used to compare DDB_G0286831 with homologous proteins from other species?

For rigorous comparative analysis of DDB_G0286831 with homologs:

  • Sequence-based comparisons:

    • Perform sensitive homology searches using PSI-BLAST, HHpred, or HMMER

    • Construct multiple sequence alignments using MAFFT or MUSCLE

    • Create phylogenetic trees using maximum likelihood or Bayesian methods

    • Identify conserved motifs and functionally important residues

  • Structural comparisons:

    • Generate structural models using AlphaFold2 or similar tools

    • Perform structural alignments using DALI, TM-align, or FATCAT

    • Calculate structural conservation scores

    • Identify conserved binding pockets or interaction surfaces

  • Functional comparisons:

    • Compare expression patterns across species and developmental stages

    • Analyze conservation of interaction partners

    • Perform cross-species complementation studies

    • Evaluate conservation of regulatory mechanisms

  • Evolutionary analysis:

    • Calculate selection pressures using dN/dS ratios

    • Identify lineage-specific adaptations

    • Analyze gene synteny across species

    • Study gene duplication and diversification patterns

How can researchers address challenges in data interpretation when working with uncharacterized proteins like DDB_G0286831?

To overcome challenges in interpreting data for uncharacterized proteins:

  • Establish robust experimental controls:

    • Include positive controls with well-characterized proteins

    • Use negative controls to establish baseline measurements

    • Implement technical replicates to assess method reliability

    • Include biological replicates to account for natural variation

  • Apply multiple complementary techniques:

    • Verify key findings using orthogonal methods

    • Combine computational predictions with experimental validation

    • Use both in vitro and in vivo approaches

    • Implement cross-species validation where possible

  • Build evidence hierarchies:

    • Assign confidence levels to different types of evidence

    • Prioritize direct experimental evidence over predictions

    • Consider consensus findings from multiple approaches

    • Acknowledge limitations and alternative interpretations

  • Collaborate and validate externally:

    • Engage with experts in specific techniques

    • Obtain independent validation of key findings

    • Use standardized protocols from established databases

    • Consider pre-registration of experimental designs

What are the potential applications of DDB_G0286831 in studying fundamental cellular processes?

DDB_G0286831 may serve as a valuable research tool for investigating:

  • Developmental biology:

    • Cell differentiation mechanisms in simple eukaryotes

    • Evolutionary conservation of developmental pathways

    • Cell-cell communication during multicellular development

    • Pattern formation in simple systems

  • Cellular stress responses:

    • Protein quality control mechanisms

    • Adaptation to environmental changes

    • Stress granule formation and function

    • Protein aggregation and disaggregation pathways

  • Evolutionary cell biology:

    • Protein function evolution in Amoebozoa

    • Comparative analysis with homologs in other eukaryotic lineages

    • Study of lineage-specific innovations

    • Conservation of fundamental cellular processes

  • Structural biology:

    • Investigation of asparagine-rich protein domains

    • Structure-function relationships in small proteins

    • Protein folding and stability mechanisms

    • Effects of amino acid repeats on protein structure

What methodological innovations might be required for comprehensive characterization of proteins like DDB_G0286831?

Future methodological advances that could enhance characterization include:

  • Improved computational approaches:

    • Enhanced AI-based structure prediction for unusual sequence compositions

    • Better algorithms for predicting function from sequence

    • Integrated multi-omics analysis platforms

    • Advanced simulation methods for protein dynamics

  • Advanced imaging techniques:

    • Super-resolution microscopy for precise localization

    • Live-cell imaging with minimal perturbation

    • Correlative light and electron microscopy

    • Single-molecule tracking in living cells

  • Novel protein engineering methods:

    • Expanded genetic code for introducing novel functionalities

    • Minimal perturbation tagging strategies

    • Domain-specific labeling approaches

    • Split protein complementation with minimal interference

  • Integrated systems biology approaches:

    • High-throughput interactome mapping

    • Automated phenotypic analysis

    • Single-cell proteomics applications

    • Multi-parameter functional screening platforms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.