Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287489 (DDB_G0287489)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0287489 (DDB_G0287489)

Recombinant DDB_G0287489 is a bioengineered version of a hypothetical protein encoded by the DDB_G0287489 gene in Dictyostelium discoideum, a model organism for studying cellular processes such as phagocytosis, differentiation, and host-pathogen interactions . While its biological function remains uncharacterized, its recombinant form is commercially available for research purposes, enabling structural and functional studies. Below, we synthesize available data on its characteristics, production, and potential applications.

Recombinant Expression System

The protein is expressed in E. coli with an N-terminal His-tag for purification. Key production details include:

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0 .

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%) for stabilization .

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

Current Knowledge Gaps

Despite its availability, DDB_G0287489 remains functionally uncharacterized. Limited data suggest:

  1. Hypothetical Role: Belongs to a family of uncharacterized proteins in D. discoideum, potentially involved in cellular processes conserved in eukaryotes .

  2. Lack of Functional Studies: No direct evidence links DDB_G0287489 to bacteriolytic activity, phagocytosis, or development, unlike other D. discoideum proteins (e.g., BadA, Kil1) .

Potential Research Directions

Area of StudyRationale
Structural AnalysisCrystallization or NMR studies to resolve tertiary structure
Functional ScreeningYeast two-hybrid or co-IP assays to identify binding partners
Knockout/Knock-in ModelsGenetic manipulation in D. discoideum to assess phenotypic effects

DDB_G0287489 vs. Bacteriolytic Proteins in D. discoideum

ProteinFunction/ActivityBacteriolytic RoleSource
DDB_G0287489UncharacterizedN/A
BadABacteriolytic activity against K. pneumoniaeConfirmed
Kil1Critical for bacterial killing in phagosomesConfirmed

Challenges and Future Outlook

  • Limited Functional Data: Existing studies on D. discoideum bacteriolytic factors (e.g., BadA, Kil1) do not mention DDB_G0287489 .

  • Technical Considerations:

    • E. coli expression may not replicate native post-translational modifications.

    • Functional redundancy in D. discoideum proteome complicates phenotypic analysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For shipments with dry ice, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
DDB_G0287489; Putative uncharacterized protein DDB_G0287489
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-87
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0287489
Target Protein Sequence
MEIENKNIKEIESIITDEIDNSNNIINNNNNGNINEHIINIQNEKKFELVELNPKFLKSP TMIVLALVLGVFSLVGLIFIIYFSIKK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.