Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292342 (DDB_G0292342)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0292342

The Recombinant Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0292342 is a protein derived from Dictyostelium discoideum, a cellular slime mold. This organism is widely used in scientific research due to its unique life cycle and ease of manipulation in laboratory settings. The protein DDB_G0292342 is expressed in Escherichia coli and is His-tagged for purification purposes . Despite its classification as uncharacterized, research into proteins like DDB_G0292342 is crucial for understanding cellular processes and discovering new biological pathways.

Characteristics of DDB_G0292342

  • Source and Host: The protein is sourced from Dictyostelium discoideum and expressed in E. coli.

  • Tag: His-tagged for easy purification.

  • Length: Full-length protein, consisting of 338 amino acids .

  • Function: Currently, the specific biochemical functions of DDB_G0292342 are not well-documented, but it is involved in several pathways within Dictyostelium discoideum.

Pathways and Interactions

DDB_G0292342 participates in various cellular pathways, although the exact mechanisms and roles are not fully elucidated. It interacts with other proteins and molecules, which can be identified through techniques like yeast two-hybrid, co-immunoprecipitation (co-IP), and pull-down assays .

Protein Structure and Function Prediction

Proteins like DDB_G0292342 can be studied using protein structure prediction methods to infer their three-dimensional structure from their amino acid sequence . This can provide insights into potential functions based on structural similarities to known proteins. Additionally, protein function prediction methods, such as homology-based and motif-based approaches, can help assign biological roles to uncharacterized proteins .

Table 1: Characteristics of Recombinant DDB_G0292342 Protein

CharacteristicDescription
SourceDictyostelium discoideum
HostEscherichia coli
TagHis-tagged
Length338 amino acids
FunctionUncharacterized

Table 2: Pathways and Interactions

Pathway/InteractionDescription
PathwaysMultiple, not fully characterized
Interacting ProteinsIdentified through yeast two-hybrid, co-IP, pull-down assays

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0292342; Putative uncharacterized protein DDB_G0292342
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0292342
Target Protein Sequence
MYNNNQNHHNNDNNMNKDEPTTIYPEFISISNEIKTNGSTNSYLNNIRREMLSMVNSGNN NNNNNNNNNNNNNNNNNNNNNNNDSIVINMDTINNNNNSNNIDINKSGYSQISNTTSNDN LNKTLLGNNEISQINDIDDDSSPEFIKYKKFISSLSYITFIGAAIVLINQKKSVYIQFHA YQSFYISMGVIGFQFLLIWSDILSIILWSLYLLFTIFMFLKVSFGGYGNSTIYKLPIIGN LSEQKAKLRSQEYSRYFKYHEDLFIKELREHKQALIHQSNLNRNNNNSNNVNNNGHQRIN SNSSSVVMSGDVESMLNSSGSNSSIYSDVQNDIGTNEE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it relevant for studying uncharacterized proteins?

Dictyostelium discoideum is a social amoeba that serves as an important model organism in molecular and cellular biology research. It occupies a unique phylogenetic position, having diverged after the split between animals, plants, and fungi, with D. discoideum being more closely related to animals than fungi are . This evolutionary position makes it valuable for comparative genomics and protein function studies.

The organism has several distinct advantages for protein characterization studies:

  • It has a fully sequenced genome consisting of 34 million base pairs with approximately 13,573 predicted genes

  • It can transition between unicellular and multicellular states, allowing for developmental biology studies

  • Many D. discoideum proteins show higher similarity to human orthologs than do those of Saccharomyces cerevisiae

  • It can be readily cultured in laboratory conditions on bacterial lawns or in liquid media

For uncharacterized proteins like DDB_G0292342, D. discoideum offers an accessible system to explore protein function through genetic manipulation, developmental biology approaches, and comparative genomics.

What genomic characteristics of Dictyostelium discoideum influence protein expression studies?

The D. discoideum genome has several distinctive features that researchers must consider when designing expression studies:

  • The genome is exceptionally A+T rich (77.6%), which can affect primer design and recombinant expression strategies

  • It contains approximately 13,573 genes, comparable to the gene count in Drosophila

  • As the first free-living protozoan to be completely sequenced, its proteome provides unique evolutionary insights

When studying an uncharacterized protein like DDB_G0292342, these genomic characteristics can affect experimental design decisions including:

  • Codon optimization for heterologous expression

  • Primer design for gene amplification

  • Interpretation of homology studies against other organisms

What standard laboratory conditions are recommended for culturing Dictyostelium when studying recombinant proteins?

Researchers can culture D. discoideum using several established methods, depending on experimental needs:

Culture MethodMedia CompositionApplicationsSpecial Considerations
Bacterial lawn cultivationAgar plates with bacterial food sourceGenetic studies, developmental analysisSimple but may introduce bacterial contaminants in protein purification
Axenic liquid cultureGlucose and peptone or defined amino acid mixturesProtein purification, biochemical analysis, proteomicsAllows for isotopic labeling of cellular components
Minimal media cultureDefined mixture of amino acids and vitaminsControlled expression studiesUseful for metabolic studies

For recombinant protein studies, axenic liquid cultures are typically preferred as they facilitate large-scale harvest and purification of cellular material without bacterial contamination . This approach is particularly valuable for isotopic labeling techniques that may be required for structural studies of uncharacterized proteins.

What expression systems are optimal for producing recombinant Dictyostelium proteins like DDB_G0292342?

When working with uncharacterized Dictyostelium proteins, researchers can choose from several expression systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest For
Endogenous Dictyostelium expressionNative post-translational modifications, Proper folding environmentLower yield than heterologous systemsFunctional studies requiring authentic modifications
E. coliHigh yield, Simple culture conditions, InexpensiveMay lack proper folding for complex proteins, No eukaryotic modificationsStructural studies requiring large protein amounts
Insect cellsEukaryotic folding machinery, Moderate to high yieldMore expensive than bacterial systemsProteins requiring complex folding
Mammalian cellsMost sophisticated post-translational modificationsMost expensive, Lower yieldsProteins where human-like modifications are critical

For uncharacterized proteins like DDB_G0292342, a staged approach is recommended:

  • Begin with small-scale expression trials in multiple systems

  • Evaluate protein solubility and activity

  • Scale up using the system that produces functional protein

Dictyostelium itself can be used as an expression host by introducing expression constructs through established transformation protocols. This homologous expression system can be particularly valuable when studying proteins in their native cellular context.

How can researchers design effective knockout or knockdown experiments to characterize DDB_G0292342?

Designing effective gene disruption studies for an uncharacterized protein requires careful planning:

Knockout Approach:

  • Design targeting constructs with homology arms flanking the DDB_G0292342 gene

  • Include a selectable marker (typically blasticidin resistance for Dictyostelium)

  • Transform Dictyostelium cells using established electroporation protocols

  • Select transformants using appropriate antibiotics

  • Verify gene disruption by PCR and/or Southern blotting

  • Perform phenotypic characterization under various conditions (growth, development, stress responses)

RNA Interference Approach:

  • Design hairpin RNA constructs targeting the DDB_G0292342 transcript

  • Clone into an inducible expression vector

  • Transform Dictyostelium cells

  • Induce expression and verify knockdown by qRT-PCR

  • Perform phenotypic characterization with appropriate controls

CRISPR-Cas9 Approach:

  • Design guide RNAs targeting DDB_G0292342

  • Introduce guide RNAs and Cas9 expression constructs

  • Select transformants and verify editing by sequencing

  • Characterize resulting phenotypes

A comprehensive phenotypic analysis should include:

  • Growth rate in axenic culture

  • Development on non-nutrient agar

  • Stress response assessment

  • Microscopic analysis of cellular structures

  • Partner protein interactions

What bioinformatic approaches are most useful for predicting the function of uncharacterized proteins in Dictyostelium?

For uncharacterized proteins like DDB_G0292342, researchers can employ multiple bioinformatic strategies:

Analytical ApproachToolsPrimary PurposeOutput
Sequence homologyBLAST, HMMERIdentify similar proteinsAligned sequences, E-values
Domain predictionInterPro, SMART, PfamIdentify functional domainsDomain architecture
Structural predictionAlphaFold, I-TASSERPredict 3D structureStructural models, confidence scores
Phylogenetic analysisMEGA, PhyMLEvolutionary relationshipsPhylogenetic trees
Co-expression analysisdictyExpressIdentify co-regulated genesExpression correlation networks
Protein-protein interaction predictionSTRINGPredict functional associationsInteraction networks

The dictyBase database (http://dictybase.org) serves as a centralized resource for Dictyostelium genomic and functional information . Researchers should use this resource as a starting point for bioinformatic analyses of uncharacterized proteins.

A structured workflow for function prediction might include:

  • Basic sequence analysis (BLAST against multiple databases)

  • Domain architecture determination

  • Structural prediction and comparison

  • Analysis of expression patterns across developmental stages

  • Co-expression network construction

  • Integration of multiple lines of evidence to generate testable hypotheses

How can developmental biology approaches help characterize the function of DDB_G0292342?

Dictyostelium's unique life cycle—transitioning between unicellular and multicellular stages—provides special opportunities for functional characterization of uncharacterized proteins:

Developmental Time Course Analysis:

  • Starve Dictyostelium cells to initiate development

  • Collect samples at defined intervals (0h, 4h, 8h, 12h, 16h, 20h, 24h)

  • Extract RNA and perform qRT-PCR for DDB_G0292342

  • In parallel, perform Western blotting to track protein levels

  • Correlate expression patterns with known developmental markers

Spatial Expression Analysis:

  • Generate a DDB_G0292342-GFP fusion protein

  • Express in Dictyostelium under native promoter

  • Track localization throughout development using fluorescence microscopy

  • Compare with known cell-type specific markers

If DDB_G0292342 is involved in developmental signaling, researchers might explore whether it functions in pathways similar to known morphogens like c-di-GMP, which has been shown to trigger stalk cell differentiation . The DgcA protein in Dictyostelium, for example, produces c-di-GMP and is expressed at the slug tip where stalk cell differentiation occurs .

What approaches are effective for resolving contradictory experimental data about DDB_G0292342 function?

When facing contradictory results in Dictyostelium protein characterization studies, researchers should follow these systematic steps:

  • Verify reagent quality and experimental conditions:

    • Confirm antibody specificity with proper controls

    • Validate knockout/knockdown efficiency

    • Ensure strain background consistency

  • Employ complementary methodologies:

    • If genetic approaches gave contradictory results, use biochemical methods

    • If in vitro studies don't match in vivo observations, develop intermediate systems

  • Design rigorous controls:

    • Include both positive and negative controls

    • Use multiple reference genes/proteins

    • Employ rescue experiments with wild-type constructs

  • Statistical validation:

    • Increase biological replicates

    • Apply appropriate statistical tests

    • Consider blinded experimental design

  • Consider experimental design factors using A-B-A-B protocols:

    • These protocols guide researchers through systematic evaluation of experimental variables

    • Evaluate stability within phases and changes between phases

    • Look for immediacy of changes and data overlap between phases

The table below illustrates a decision framework for resolving contradictory data:

Contradiction TypePrimary Resolution StrategySecondary ApproachValidation Method
Expression pattern discrepanciesStandardize growth conditionsMultiple detection methodsqRT-PCR with multiple primers
Localization conflictsTest tag position effectsDifferent microscopy techniquesSubcellular fractionation
Phenotype inconsistenciesGenetic background analysisTemperature/medium variationRescue experiments
Interaction differencesVary interaction detection methodsIn vitro vs. in vivo approachesDirect binding assays

How can structural biology approaches be applied to characterize DDB_G0292342?

For uncharacterized proteins like DDB_G0292342, structural biology provides crucial insights into potential function:

Recombinant Protein Production for Structural Studies:

  • Optimize expression constructs (full-length vs. domains)

  • Screen multiple expression systems (see section 2.1)

  • Develop purification protocol optimized for structural studies

  • Verify protein quality via circular dichroism and dynamic light scattering

Structural Determination Options:

MethodResolutionSample RequirementsAdvantagesLimitations
X-ray crystallographyAtomic (0.5-3Å)Diffracting crystalsHighest resolutionCrystallization challenges
Cryo-electron microscopyMedium-high (2-4Å)Purified protein (>100kDa ideal)No crystals neededSize limitations for small proteins
NMR spectroscopyAtomic for small proteinsIsotope-labeled proteinDynamic informationSize limitations (~30kDa)
Small-angle X-ray scatteringLow (10-30Å)Monodisperse solutionWorks with flexible proteinsLimited resolution

Dictyostelium's ability to grow in defined media facilitates isotopic labeling for NMR studies . For challenging proteins, researchers might employ integrative structural biology approaches combining multiple techniques.

Once structural data is obtained, computational approaches including molecular docking and dynamics simulations can provide functional hypotheses that guide subsequent biochemical experiments.

What statistical approaches are recommended for analyzing protein expression and localization data?

When analyzing data for uncharacterized proteins in Dictyostelium, researchers should implement appropriate statistical methods:

For Expression Analysis:

  • Normalize expression data to validated reference genes specific to Dictyostelium

  • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

  • Consider time-series analysis methods for developmental expression patterns

  • Account for batch effects in multi-experiment comparisons

For Localization Analysis:

  • Quantify colocalization using established metrics (Pearson's correlation, Manders' coefficients)

  • Employ automated image analysis to reduce observer bias

  • Use statistical tests that account for spatial correlation

  • Consider single-cell variation in mixed populations

For visual data analysis, researchers can employ systematic protocols similar to those developed for single-case research designs . These protocols guide analysts through evaluating data patterns such as:

  • Level, trend, and variability within experimental phases

  • Immediacy of effects between phases

  • Overlap between data from different phases

  • Consistency of patterns across replications

How should researchers effectively present data for publication when studying uncharacterized proteins?

When presenting results from studies of uncharacterized proteins like DDB_G0292342, follow these guidelines:

Table Design Principles:

  • Ensure titles clearly describe table contents

  • Use descriptive column headers that indicate data nature

  • Design tables to be understandable without reference to text

  • Divide large datasets into clear categories in appropriately titled columns

  • Limit tables to essential information that cannot be adequately presented in text

Guidelines for Choosing Data Presentation Format:

Use a Table WhenUse a Figure WhenUse Text When
Showing many precise numerical values in small spaceShowing trends, patterns and relationships between datasetsData is not extensive
Comparing data values with several shared characteristicsSummarizing research resultsData would create a table with 2 or fewer columns
Showing presence/absence of specific characteristicsPresenting visual explanation of a sequence of eventsData is irrelevant to main study findings

Adapted from

For Developmental Studies:

  • Present time-course data with appropriate time points

  • Include both unicellular and multicellular stages

  • Show representative images alongside quantitative data

  • Include appropriate developmental markers as controls

For Protein Characterization:

  • Present evidence from multiple approaches

  • Include negative and positive controls

  • Show both raw data and processed results where appropriate

  • Present conflicting results transparently with possible explanations

How can multi-omics approaches help characterize DDB_G0292342 in Dictyostelium?

For comprehensive characterization of uncharacterized proteins, researchers should consider integrated multi-omics approaches:

Omics ApproachMethodologyApplication to DDB_G0292342Data Integration
TranscriptomicsRNA-Seq, microarraysExpression patterns across conditionsCorrelation with developmental markers
ProteomicsMass spectrometryProtein abundance, modificationsValidation of expression data
InteractomicsCo-IP-MS, BioID, Y2HProtein-protein interactionsNetwork analysis
MetabolomicsLC-MS, GC-MSMetabolic impacts of proteinPathway analysis
PhenomicsHigh-content screeningFunctional outcomesClustering of phenotypes

Integrating these approaches provides a comprehensive view of protein function. For example, if transcript and protein levels of DDB_G0292342 peak during specific developmental stages, this can be correlated with metabolite profiles and phenotypic outcomes to generate functional hypotheses.

Researchers studying uncharacterized proteins should leverage dictyBase, which integrates genomic data with experimental results to provide a structured repository of Dictyostelium research . This database includes information from high-throughput experiments such as large-scale mutagenesis and microarray-based gene expression studies .

What comparative approaches between Dictyostelium and other organisms can illuminate DDB_G0292342 function?

Comparative studies can provide valuable functional insights for uncharacterized proteins:

Cross-Species Comparative Analysis Process:

  • Identify potential homologs in other species using tools like BLAST and HMMER

  • Perform detailed sequence alignment focusing on conserved domains

  • Examine synteny relationships (conservation of gene order)

  • Compare expression patterns in equivalent developmental processes

  • Test for functional complementation across species

Dictyostelium's evolutionary position—branching after the split between plants, animals, and fungi, but more closely related to animals—makes it valuable for evolutionary studies . For proteins like DDB_G0292342, researchers might explore whether similar proteins exist in other Dictyostelids and whether they serve conserved functions.

For example, researchers studying DgcA in Dictyostelium found that species representing all major groups of Dictyostelia contain conserved diguanylate cyclases that were previously only found in eubacteria . This comparative approach revealed evolutionary conservation of signaling mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.