Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0280915 (DDB_G0280915)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0280915; Putative uncharacterized transmembrane protein DDB_G0280915
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0280915
Target Protein Sequence
MIFKINKIKNVHMYDVAIILILIIVVFKLIKSEDSKFLNNNVQFEQTKDNKFGVNSTKLN FLFNFLSSSSNKSVFEIQKKNINNNYNNNNYNNNSKKSYNYIIVGELNRNKIIRPSDIQR EISEINTVEKTVDIKEKRLGSFKRGVLKIPLAFVQMIAISIALICLLIP
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What Are The Best Expression Systems For Producing Recombinant DDB_G0280915?

Multiple expression systems have been utilized for recombinant production of Dictyostelium proteins, each with advantages for different research applications:

Expression SystemAdvantagesChallengesApplications
E. coliHigh yield, simple cultivation, cost-effectiveLimited post-translational modifications, inclusion body formationStructural studies, antibody production
Cell-free expressionRapid production, direct incorporation into liposomesLower yields, higher costFunctional studies, proteoliposome preparation
DictyosteliumNative environment, proper foldingComplex cultivation, lower yieldsFunctional studies in native context
Insect cellsHigher yields than mammalian cells, some post-translational modificationsComplex cultivationStructural and functional studies

For DDB_G0280915 specifically, E. coli has been successfully used with an N-terminal His-tag fusion approach yielding high purity (>90% as determined by SDS-PAGE) . The recombinant protein is typically supplied as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For functional studies, researchers might consider the "bilayer-dialysis" (BD) reaction format, which combines bilayer protein expression with dialysis for more efficient buffer exchange and has shown up to four-fold higher yields than standard methods for membrane proteins . This approach is particularly valuable for transmembrane proteins like DDB_G0280915.

Purification Protocol:

  • Cell Lysis: For E. coli-expressed DDB_G0280915, use sonication or high-pressure homogenization in a suitable buffer (typically Tris-based, pH 8.0)

  • Affinity Chromatography: Using the N-terminal His-tag, purify via nickel or cobalt resin affinity chromatography

    • Binding: Load clarified lysate onto equilibrated resin

    • Washing: Remove non-specific binding proteins with low imidazole (10-20 mM)

    • Elution: Recover DDB_G0280915 with high imidazole (250-500 mM)

  • Size Exclusion Chromatography: Further purify using gel filtration to remove aggregates and obtain monodisperse protein

  • Buffer Exchange: Replace elution buffer with storage buffer (Tris/PBS-based buffer, 6% Trehalose, pH 8.0)

  • Concentration and Storage: Concentrate to desired concentration, flash-freeze in liquid nitrogen, and store at -20°C/-80°C

Validation Methods:

Validation MethodPurposeAnalysis Parameters
SDS-PAGEPurity assessment>90% purity standard
Western blotIdentity confirmationUsing anti-His or specific antibodies
Mass spectrometryMolecular weight and sequence verificationPrecise mass determination, peptide mapping
Circular dichroismSecondary structure assessmentAlpha-helical content expected for transmembrane regions
Dynamic light scatteringHomogeneity analysisMonodisperse preparation indicates quality

For membrane proteins like DDB_G0280915, additional validation may include reconstitution into liposomes and assessing membrane integration through protease protection assays or fluorescence-based techniques .

What Methods Are Best For Detecting DDB_G0280915 In Cellular Samples?

For reliable detection of DDB_G0280915 in cellular samples, multiple complementary approaches should be considered:

Antibody-Based Detection:

  • Western Blotting:

    • Requires membrane fraction isolation from Dictyostelium cells

    • SDS-PAGE followed by transfer to PVDF or nitrocellulose membrane

    • Detection using recombinant antibodies specific to DDB_G0280915

    • Alternative: anti-His antibodies for tagged recombinant protein

  • Immunofluorescence Microscopy:

    • Fixation with 4% paraformaldehyde

    • Permeabilization with 0.1% Triton X-100

    • Blocking with 1% BSA

    • Incubation with primary antibodies against DDB_G0280915

    • Visualization with fluorophore-conjugated secondary antibodies

    • Co-staining with membrane markers for localization studies

Genetic Tagging Approaches:

  • Fluorescent Protein Fusion:

    • Create C-terminal GFP/RFP fusion constructs

    • Express in Dictyostelium using standard transformation protocols

    • Live-cell imaging for spatiotemporal dynamics

  • HaloTag System:

    • Generate HaloTag fusions for single-molecule tracking

    • Label with membrane-permeable HaloTag ligands

    • Enables single-molecule imaging and diffusion analysis

Transcriptional Analysis:

  • RT-PCR/qPCR:

    • Design primers specific to DDB_G0280915 coding sequence

    • Extract RNA from cells at different developmental stages

    • Quantify expression relative to housekeeping genes

  • RNA-Seq:

    • Global expression analysis across developmental stages

    • Compare expression patterns with other transmembrane proteins

The development of the recombinant antibody toolbox specifically for Dictyostelium proteins provides powerful reagents for detection and characterization . These recombinant antibodies offer advantages of reproducibility and renewable supply compared to traditional polyclonal antibodies.

How Does Lateral Diffusion Of DDB_G0280915 Compare To Other Transmembrane Proteins?

Lateral diffusion characteristics provide important insights into membrane protein function and organization. While specific data for DDB_G0280915 is not directly reported, comprehensive studies of transmembrane proteins in Dictyostelium reveal patterns likely applicable to this protein .

Key Findings in Dictyostelium Transmembrane Protein Diffusion:

  • Three Diffusion States: All studied transmembrane proteins (with 1-10 transmembrane domains) exhibited three free diffusion states with remarkably similar diffusion coefficients regardless of structural variability .

  • Cytoskeletal Dependence: All transmembrane proteins showed similar mobility reductions when microtubule dynamics, actin cytoskeleton, or myosin II were inhibited .

  • Size-Diffusion Relationship: The relationship between protein size and diffusion coefficient follows the Saffman–Delbrück model, indicating membrane viscosity, not protein size, is the primary determinant of diffusion rates .

Experimental Methods for Studying DDB_G0280915 Diffusion:

  • Single-Molecule Imaging:

    • HaloTag-DDB_G0280915 fusion protein expression

    • Labeling with membrane-permeable HaloTag ligands conjugated to fluorophores

    • Total internal reflection fluorescence microscopy (TIRFM) at 30 frames/second

    • Analysis of single-molecule trajectories

  • Analytical Framework:

    • Mean square displacement (MSD) calculation

    • Hidden Markov modeling for diffusion state identification

    • Comparison with known membrane proteins

  • Field Model Application:

    • Analysis within the framework of the field model for multistate lateral diffusion

    • Characterization of membrane regions with different viscosities

Based on studies of similar proteins, DDB_G0280915 would likely exhibit diffusion coefficients in the range of 0.019-0.033 μm²/s, with its specific pattern informing on its membrane organization and function .

How Is DDB_G0280915 Expression Regulated During Dictyostelium Development?

Understanding the developmental regulation of DDB_G0280915 requires examining both transcriptional and post-transcriptional control mechanisms throughout Dictyostelium's unique life cycle.

Dictyostelium undergoes a 24-hour developmental program transitioning from unicellular amoebae to multicellular structures . This process involves significant remodeling of the proteome, including membrane proteins.

Developmental Expression Patterns:

Studies of plasma membrane proteins in Dictyostelium have identified two general classes :

  • High-abundance "housekeeping" proteins: Present in vegetative cells and largely conserved through development

  • Low-abundance stage-specific proteins: Expressed at specific developmental stages with presumed specialized functions

Without specific data on DDB_G0280915, we can outline methodological approaches to determine its pattern:

Research Methodology:

  • Transcriptional Analysis:

    • RNA extraction at defined developmental timepoints: vegetative growth, early aggregation, mound formation, and culmination

    • qRT-PCR with primers specific for DDB_G0280915

    • RNA-seq comparison across developmental stages

  • Protein Level Analysis:

    • Metabolic labeling with [35S]methionine at different developmental stages

    • Two-dimensional gel electrophoresis to track protein synthesis

    • Western blotting of samples from multiple developmental timepoints

  • Reporter Constructs:

    • Fusion of DDB_G0280915 promoter with reporter genes (GFP, lacZ)

    • Visualization of temporal and spatial expression patterns

  • Pulse-Chase Experiments:

    • Analysis of protein turnover rates during development

    • Determination of protein half-life at different stages

Based on studies of other transmembrane proteins, we might expect specific developmental regulation of DDB_G0280915, potentially with increased expression during particular morphogenetic events if it has a stage-specific function .

What CRISPR-Cas9 Strategies Are Most Effective For Studying DDB_G0280915 Function?

CRISPR-Cas9 technology has been successfully adapted for Dictyostelium, enabling precise genetic manipulation for functional studies . For DDB_G0280915, several CRISPR strategies can be implemented:

Gene Knockout Approach:

  • Guide RNA Design:

    • Target early exons to ensure complete loss of function

    • Design multiple gRNAs to increase efficiency

    • Avoid off-target sites using appropriate design tools

  • Delivery Method:

    • Electroporation of Cas9-gRNA ribonucleoprotein complexes

    • Alternatively, plasmid-based delivery following protocols for Dictyostelium transformation

  • Selection Strategy:

    • Co-transformation with antibiotic resistance marker

    • Selection with appropriate antibiotic after 5-hour recovery period

  • Validation Methods:

    • PCR verification of genomic modification

    • RT-PCR confirmation of transcript absence

    • Western blot verification of protein loss

Precise Gene Editing Applications:

Editing ApproachApplication for DDB_G0280915Expected Outcome
Point mutationsAlter key residues in transmembrane regionsDetermine critical amino acids for function
Domain deletionRemove specific protein segmentsIdentify functional domains
Epitope taggingInsert detection tagsEnable protein tracking without separate constructs
Fluorescent protein knock-inInsert GFP at endogenous locusVisualize native expression and localization

Phenotypic Analysis of Mutants:

  • Growth Characteristics:

    • Cell doubling time in axenic media

    • Colony morphology on bacterial lawns

  • Developmental Phenotypes:

    • Timing and morphology of multicellular structures

    • Cell-type differentiation patterns

    • Spore viability and germination efficiency

  • Cellular Processes:

    • Cell motility and chemotaxis parameters

    • Phagocytosis and macropinocytosis rates

    • Resistance to various stressors

Special consideration should be given to growth conditions when working with CRISPR-modified strains. For Dictyostelium transformations, bacteria-grown cells may be harvested from the feeding front on SM agar plates with Klebsiella aerogenes .

What Are The Challenges In Reconstituting DDB_G0280915 Into Functional Proteoliposomes?

Reconstituting membrane proteins like DDB_G0280915 into proteoliposomes presents specific challenges but is essential for functional studies. These challenges and corresponding methodological solutions are outlined below:

Major Challenges:

  • Protein Denaturation: Transmembrane proteins often lose their native structure during purification and reconstitution

  • Orientation Control: Achieving the correct membrane topology (inside-out vs. right-side-out) is difficult but critical for function

  • Lipid Composition: The specific lipid environment significantly affects membrane protein behavior and function

  • Reconstitution Efficiency: Low incorporation rates often limit functional studies

  • Functional Validation: Confirming proper folding and function in the artificial membrane environment

Direct Expression-Reconstitution Approach:

The "bilayer-dialysis" (BD) reaction format offers a promising solution by directly incorporating newly synthesized membrane proteins into liposomes during cell-free expression :

  • Liposome Preparation:

    • Use asolectin (a mixture of natural phospholipids) for broad compatibility

    • Rehydrate lyophilized liposomes directly in the translation reaction

  • Cell-Free Expression:

    • High-performance wheat germ system (e.g., WEPRO®7240)

    • Combined with bilayer method and dialysis

  • Isolation of Proteoliposomes:

    • Simple centrifugation step following expression

    • Yields sufficient purity for many applications

This approach has shown up to four times higher protein yields compared to standard methods for membrane proteins .

Conventional Reconstitution Approach:

For pre-purified DDB_G0280915 , conventional reconstitution methods can be employed:

  • Detergent Solubilization:

    • Solubilize purified protein in mild detergents (DDM, LDAO, etc.)

    • Mix with lipids in detergent solution

  • Detergent Removal:

    • Bio-Beads or dialysis to remove detergent

    • Controlled rate of removal to ensure proper incorporation

  • Quality Control:

    • Freeze-fracture electron microscopy to assess protein incorporation

    • Dynamic light scattering for size distribution

    • Protease protection assays to determine orientation

The choice of lipids significantly impacts success rates, with asolectin offering broad compatibility for initial studies before optimization with defined lipid mixtures reflecting the native Dictyostelium membrane composition .

How Can Protein-Protein Interactions Of DDB_G0280915 Be Identified And Validated?

Identifying the interaction partners of DDB_G0280915 is crucial for understanding its cellular function. Given the challenges associated with transmembrane proteins, multiple complementary approaches should be employed:

Primary Identification Methods:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express His-tagged DDB_G0280915 in Dictyostelium

    • Solubilize complexes with appropriate detergents (e.g., digitonin, DDM)

    • Capture on Ni-NTA resin and elute

    • Identify co-purifying proteins by LC-MS/MS

    • Compare to control purifications to identify specific interactors

  • Proximity Labeling Approaches:

    • Generate BioID or TurboID fusion with DDB_G0280915

    • Express in Dictyostelium cells

    • Provide biotin for labeling proximal proteins

    • Isolate biotinylated proteins and identify by mass spectrometry

    • Particularly valuable for transmembrane proteins with transient interactions

  • Yeast Two-Hybrid Membrane System:

    • Use modified split-ubiquitin system designed for membrane proteins

    • Screen Dictyostelium cDNA library

    • Validate candidates through secondary screening

Validation Strategies:

Validation MethodApproachAdvantages
Co-immunoprecipitationReverse pull-down with antibodies against identified partnersConfirms interaction in native context
Bimolecular Fluorescence Complementation (BiFC)Express protein fragments fused to potential partnersVisualizes interactions in living cells
Fluorescence Resonance Energy Transfer (FRET)Tag DDB_G0280915 and partner with appropriate fluorophoresDetects direct interactions within 10 nm
Crosslinking Mass SpectrometryChemical crosslinking followed by MS analysisIdentifies interaction interfaces
Co-localizationFluorescent tagging and microscopyProvides spatial context for interaction

Data Analysis and Integration:

For network construction and functional inference:

  • Interaction Network Analysis:

    • Create protein interaction maps

    • Identify functional clusters

  • Gene Ontology Enrichment:

    • Analyze overrepresented functional categories among interactors

  • Comparative Analysis:

    • Compare to interaction networks of other transmembrane proteins

    • Identify unique and shared components

Given the uncharacterized nature of DDB_G0280915, its interaction partners would provide valuable clues to its function in cellular processes such as cell movement, chemotaxis, or differentiation .

What Role Does DDB_G0280915 Play In Host-Pathogen Interactions In Dictyostelium?

Dictyostelium discoideum serves as an important model for studying host-pathogen interactions, particularly phagocytosis and bacterial sensing . While the specific role of DDB_G0280915 in these processes remains to be fully characterized, we can examine potential functions based on its transmembrane nature and research approaches to investigate this question.

Potential Roles in Host-Pathogen Interactions:

  • Bacterial Recognition:

    • As a transmembrane protein, DDB_G0280915 could function as a pattern recognition receptor

    • May participate in sensing bacterial components during phagocytosis

  • Phagocytic Process:

    • Could contribute to phagosome formation or maturation

    • May regulate membrane dynamics during engulfment

  • Signaling Pathway Component:

    • Might transduce signals from bacterial recognition to cellular response

    • Could interact with known regulators of bacterial defense

Research Methodologies:

To investigate DDB_G0280915's role in host-pathogen interactions:

  • Infection Assays with Gene Knockout:

    • Generate DDB_G0280915 knockout using CRISPR-Cas9

    • Challenge with various bacterial species (E. coli, K. pneumoniae, etc.)

    • Quantify phagocytosis rates, bacterial killing efficiency, and survival

  • Localization During Infection:

    • Create fluorescently tagged DDB_G0280915

    • Perform live-cell imaging during bacterial challenge

    • Track protein dynamics relative to phagocytic markers

  • Bacterial Binding Studies:

    • Express recombinant DDB_G0280915 ectodomain

    • Perform binding assays with various bacterial components

    • Identify specific ligands if applicable

  • Comparative Genomics:

    • Analyze DDB_G0280915 conservation across species

    • Compare sequence with known bacterial recognition proteins

Key Research Questions:

  • Does DDB_G0280915 localize to phagosomes during bacterial uptake?

  • Does loss of DDB_G0280915 affect bacterial phagocytosis or killing?

  • Does DDB_G0280915 interact with known components of the phagocytic machinery?

  • Are DDB_G0280915 expression levels regulated during bacterial challenge?

Based on research in Dictyostelium, transmembrane proteins have been shown to play crucial roles in sensing, phagocytosis, and killing of bacteria. For example, the leucine-rich repeat kinase LrrkA regulates these processes , suggesting other transmembrane proteins like DDB_G0280915 may have similar functions in bacterial defense mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.