Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0281465 (DDB_G0281465)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Dictyostelium discoideum Putative Uncharacterized Transmembrane Protein DDB_G0281465 (DDB_G0281465) is a bacterially expressed protein derived from the social amoeba D. discoideum. While its precise biological function remains uncharacterized, it is hypothesized to play roles in membrane-associated processes due to its structural features. This protein is cataloged under UniProt ID Q54TW5 and has been commercially produced for research applications .

Primary Structure

  • Amino Acid Sequence: The full-length protein comprises 451 residues. Key regions include a predicted transmembrane domain and a signal peptide indicative of secretory or membrane localization .

Physical Properties

PropertyValue
Molecular Weight~50 kDa (theoretical)
Isoelectric Point (pI)Predicted acidic due to residue composition
TagN-terminal His-tag for purification
Expression HostEscherichia coli
Purity>90% (confirmed by SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Production and Purification

Recombinant DDB_G0281465 is synthesized in E. coli using codon-optimized expression vectors. Key steps include:

  1. Lysis: Cells are sonicated in a Tris/PBS buffer with protease inhibitors .

  2. Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography .

  3. Storage: Lyophilized powder stable at -20°C/-80°C; reconstitution in sterile water with 50% glycerol recommended for long-term usability .

Comparative Analysis with Related Proteins

D. discoideum encodes multiple uncharacterized transmembrane proteins, such as DDB_G0292058 (UniProt Q54DS3). Unlike DDB_G0281465, DDB_G0292058 has been linked to bacteriolytic activity in phagosomes, suggesting functional divergence among paralogs .

FeatureDDB_G0281465DDB_G0292058
Length451 aa553 aa
Expression HostE. coliE. coli
Known FunctionUncharacterizedHypothetical bacteriolytic activity
ConservationDUF3430 domain absentContains DUF3430 domain

Challenges and Future Directions

  • Functional Elucidation: No in vitro or in vivo activity data exist for DDB_G0281465. Targeted knockout studies in D. discoideum could clarify its role in membrane dynamics or stress responses .

  • Structural Biology: Cryo-EM or X-ray crystallography may resolve its tertiary structure and ligand-binding sites .

  • Evolutionary Context: Phylogenetic analysis could determine if this protein family is unique to Dictyostelids or conserved in higher eukaryotes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate your preference during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate with us and we will prioritize developing the specified tag.
Synonyms
DDB_G0281465; Putative uncharacterized transmembrane protein DDB_G0281465
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0281465
Target Protein Sequence
MEISPTKIKSVLLKLIQILFFTISISIYIDLVGNSNNKNNINNNINNEELLLNKQIQIYY WFVGIILFSIAWSIGTFKWLSRFFLTFFIIKSIQQLIQHLPIEFYDKLRNLIVFGTFSKF DFTSTGIITESLPTLYDNFFGGNISPFSIEIIGIQSCLIIFFSTLGFNIYLADKFWLIKT IIVDWIISAILLIIFSITDLLMNQSNVYSVISYIFGSNVLGFGTIKIQEFLWNLSSKYDD KLNSTIIKSTKSNNNNNNNNNNKQDDNIIYDTDSSFNGQSSSSSSSSSSSSSSSSSATTT TTTLVNDNSIISEYVTEKIMIEENGEIKEQEVQVDKLDYSKLNEDQLNAILSEPILETQI TTRNVSYHKSTRFINNLIAPENINSRISAKEFVGVIILWVYTISNFIISDYSLLTIPNIL VVVGFSGTILTYLSTISAKRLTNKNPSKREC
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of the transmembrane protein DDB_G0281465?

DDB_G0281465 is a putative uncharacterized transmembrane protein in Dictyostelium discoideum with limited functional annotation. Based on structural analyses, this protein contains multiple α-helical transmembrane domains that span the plasma membrane. Structural prediction tools like AlphaFold can be employed to generate 3D models of the protein, revealing potential functional domains . For accurate structure prediction, researchers should extract the genomic DNA using standard protocols, amplify the gene using PCR with Phusion High Fidelity DNA Polymerase, and sequence the product to confirm the predicted transmembrane regions .

How does the lateral diffusion of DDB_G0281465 compare to other transmembrane proteins in Dictyostelium discoideum?

Studies on transmembrane proteins in Dictyostelium discoideum have revealed that all transmembrane proteins, regardless of their structural complexity, undergo free diffusion with similar diffusion coefficients despite significant differences in transmembrane region numbers . Research utilizing hidden Markov model (HMM) analysis of single-molecule trajectories indicates that DDB_G0281465, like other transmembrane proteins, would likely exhibit three distinct states of free diffusion. The diffusion characteristics are primarily determined by the membrane environment rather than the intrinsic properties of the protein itself . This conforms to the Saffman-Delbrück model, where membrane viscosity heterogeneity is the major determinant of lateral mobility.

What experimental approaches are recommended for studying DDB_G0281465 expression patterns during Dictyostelium development?

To study expression patterns of DDB_G0281465 during development, researchers should implement a dual approach combining proteomic and transcriptomic analyses. For proteomics, compare whole-cell proteome analysis between vegetative and developed (cAMP-pulsed) cells using mass spectrometry . For transcriptomics, isolate RNA from cells at different developmental stages and perform RNA sequencing . Integration of these datasets allows for identification of differential expression patterns. Researchers should synchronize development by starving cells in Development Buffer (DB: 5 mM NaH₂PO₄, 5 mM Na₂HPO₄, 2 mM MgSO₄, 0.2 mM CaCl₂) and pulse with cAMP (50-100 nM) every 6 minutes for 4-6 hours .

What are the optimal conditions for expressing recombinant DDB_G0281465 for functional studies?

For optimal recombinant expression of DDB_G0281465, construct expression vectors with C-terminal tags (such as HaloTag or His-tag) to facilitate protein purification and detection without disrupting transmembrane insertion . Electroporate the expression plasmids into Dictyostelium cells using the ECM 830 Square Wave Electroporation System with the following parameters: 500 V effective voltage, 100 μsec pulse width, 1.0 sec pulse interval, and 15 pulse number . For heterologous expression in bacterial systems, consider using specialized E. coli strains designed for membrane protein expression (such as C41/C43) with reduced induction temperatures (16-20°C) to prevent protein aggregation.

How can single-molecule imaging be implemented to study DDB_G0281465 dynamics in living cells?

To implement single-molecule imaging of DDB_G0281465, express the protein fused to HaloTag at the C-terminus in Dictyostelium cells . Label the fusion protein with membrane-permeable fluorescent HaloTag ligands at nanomolar concentrations. Perform total internal reflection fluorescence (TIRF) microscopy to visualize single molecules at the cell surface with high signal-to-noise ratio. For trajectory analysis:

  • Acquire time-lapse images (30-100 frames per second)

  • Track individual molecules using a single-particle tracking algorithm

  • Calculate mean square displacement (MSD) for different time intervals

  • Apply hidden Markov modeling to identify different diffusion states

  • Quantify transition probabilities between states

The diffusion coefficient can be calculated using the relationship MSD = 4Dt for 2D diffusion, where D is the diffusion coefficient and t is time .

What approaches should be used to investigate protein-protein interactions involving DDB_G0281465?

To investigate protein-protein interactions of DDB_G0281465, implement a multi-faceted approach:

  • Proximity-based labeling: Express DDB_G0281465 fused to a proximity labeling enzyme (BioID or APEX2) in Dictyostelium cells. After biotin labeling, perform streptavidin pull-down followed by mass spectrometry to identify proximal proteins.

  • Co-immunoprecipitation: Generate antibodies against DDB_G0281465 or use tag-based pull-down approaches with the recombinant protein . Perform western blot analysis to detect potential binding partners.

  • Membrane two-hybrid assays: Adapt split-ubiquitin or MYTH (membrane yeast two-hybrid) systems for screening interacting partners in a high-throughput manner.

  • Cross-linking mass spectrometry: Use membrane-permeable cross-linkers to stabilize transient interactions before cell lysis and mass spectrometry identification.

Validate identified interactions using fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) in living Dictyostelium cells .

How should researchers design experiments to assess the role of DDB_G0281465 in starvation response?

To assess DDB_G0281465's role in starvation response, design experiments that compare wild-type and DDB_G0281465-knockout Dictyostelium strains. Generate knockout strains using CRISPR-Cas9 or homologous recombination techniques. Design the following experimental workflow:

  • Culture cells in nutrient-rich medium to mid-log phase

  • Transfer cells to starvation buffer (DB without nutrients)

  • Sample cells at regular intervals (0, 2, 4, 6, 8, 12 hours)

  • Analyze:

    • Cell viability using flow cytometry with propidium iodide staining

    • Changes in extracellular polyphosphate (polyP) accumulation, as starvation induces polyP accumulation in Dictyostelium

    • Membrane fluidity changes using fluorescence recovery after photobleaching (FRAP)

    • Rates of macropinocytosis, exocytosis, and phagocytosis using fluorescent tracers

    • Transcriptional changes of starvation-response genes using RT-qPCR

The starvation response in Dictyostelium involves decreased membrane fluidity and reduced macropinocytosis, exocytosis, and phagocytosis . Compare these parameters between wild-type and knockout strains to elucidate DDB_G0281465's role.

What controls and variables should be considered when studying the membrane localization of DDB_G0281465?

When studying membrane localization of DDB_G0281465, consider the following controls and variables:

Essential controls:

  • Empty vector transfection control

  • Cytosolic protein control (non-membrane protein)

  • Well-characterized transmembrane protein control with known localization pattern

  • Labeling controls to distinguish specific from non-specific signals

Key variables to consider:

  • Cell density (affects starvation status and potentially protein localization)

  • Developmental stage (vegetative vs. developed cells)

  • Membrane composition modifications using lipid-modifying drugs

  • Temperature variations (affects membrane fluidity)

  • Cytoskeletal perturbations using drugs like Latrunculin A

Cellular fractionation approach:

  • Prepare membrane fractions using ultracentrifugation (100,000 × g)

  • Extract peripheral membrane proteins with high salt buffer

  • Extract integral membrane proteins with detergents

  • Analyze fractions by western blotting

  • Use confocal microscopy with fluorescently-tagged DDB_G0281465 to visualize subcellular localization

How can researchers differentiate between the three diffusion states of DDB_G0281465 in the plasma membrane?

To differentiate between the three diffusion states of DDB_G0281465 in the plasma membrane, implement the following quantitative approach:

  • Perform single-molecule tracking of HaloTag-labeled DDB_G0281465 at high temporal resolution (≥30 frames per second)

  • Calculate the instantaneous diffusion coefficient for each trajectory segment

  • Apply hidden Markov modeling (HMM) to classify diffusion states statistically

  • Generate diffusion coefficient distribution histograms to identify distinct populations

Based on studies of transmembrane proteins in Dictyostelium, expect to observe three distinct diffusion states with the following characteristics:

Diffusion StateDiffusion Coefficient (μm²/s)Lifetime (seconds)Membrane Domain
Fast0.2-0.40.1-0.3Low viscosity
Intermediate0.05-0.150.3-0.8Medium viscosity
Slow0.005-0.020.8-2.0High viscosity

To validate these states, perform membrane viscosity perturbation experiments using cholesterol-modifying agents or temperature variations, and observe the resulting shifts in diffusion state distributions .

How should researchers analyze contradictory results between proteomic and transcriptomic data for DDB_G0281465?

When confronting contradictory results between proteomic and transcriptomic data for DDB_G0281465, implement this systematic analysis approach:

  • Temporal resolution analysis: Examine whether the contradiction stems from different sampling timepoints, as post-transcriptional regulation can create temporal delays between mRNA and protein expression changes.

  • Data normalization assessment: Review normalization methods used in both datasets. Different normalization approaches can introduce systematic biases.

  • Technical validation: Perform targeted validation using:

    • RT-qPCR for transcript levels

    • Western blotting for protein levels

    • Fluorescent reporter constructs to monitor real-time expression

  • Post-transcriptional regulation investigation: Examine:

    • microRNA targeting potential

    • RNA-binding protein interactions

    • Protein degradation rates using cycloheximide chase experiments

  • Statistical re-analysis: Calculate the correlation coefficient between transcript and protein levels across multiple timepoints. Notably, studies in Dictyostelium have shown approximately 70% concordance between proteomic and transcriptomic data during development , so some discrepancies are expected.

  • Biological interpretation framework: Consider a model where early developmental regulation occurs first at the transcriptional level, followed by protein-level regulation through degradation or post-translational modifications.

What statistical approaches are appropriate for analyzing lateral diffusion data of DDB_G0281465?

For analyzing lateral diffusion data of DDB_G0281465, implement the following statistical approaches:

  • Mean Square Displacement (MSD) analysis:

    • Calculate MSD for different time intervals using the equation: MSD(τ) = ⟨|r(t+τ) - r(t)|²⟩

    • Plot MSD versus time to determine diffusion type:

      • Linear relationship (MSD ∝ τ) indicates free diffusion

      • Sublinear relationship (MSD ∝ τᵅ, where α < 1) indicates confined diffusion

      • Superlinear relationship (MSD ∝ τᵅ, where α > 1) indicates directed motion

  • Hidden Markov Model (HMM) analysis:

    • Implement maximum likelihood estimation to determine the optimal number of diffusion states

    • Use Bayesian Information Criterion (BIC) to prevent overfitting

    • Calculate transition probabilities between states

    • Determine state lifetimes and stationary distributions

  • Displacement distribution analysis:

    • For each time interval, plot the probability distribution of displacements

    • Fit with Gaussian mixture models to identify multiple diffusion populations

    • Apply Kolmogorov-Smirnov test to compare distributions between experimental conditions

  • Residence time analysis:

    • Calculate how long molecules remain in specific membrane regions

    • Fit residence time distributions with exponential decay functions to determine characteristic residence times

  • Field model simulation validation:

    • Generate simulated trajectories based on the proposed membrane field model

    • Compare simulated and experimental data using statistical tests to validate the model

How can researchers determine if DDB_G0281465 function is conserved across different species?

To determine if DDB_G0281465 function is conserved across species, implement this comprehensive comparative analysis workflow:

  • Sequence homology analysis:

    • Perform BLAST searches against protein databases from various organisms

    • Identify orthologs and paralogs based on sequence similarity thresholds

    • Construct multiple sequence alignments using MUSCLE or CLUSTALW

    • Generate phylogenetic trees to visualize evolutionary relationships

  • Domain architecture comparison:

    • Identify conserved domains using InterPro, Pfam, or SMART

    • Compare transmembrane topology predictions using TMHMM or Phobius

    • Analyze conservation of specific functional motifs

  • Structural comparison:

    • Generate 3D structural models using AlphaFold or other prediction tools

    • Superimpose structures of DDB_G0281465 and its homologs

    • Calculate RMSD values to quantify structural similarity

    • Identify conserved structural features potentially involved in function

  • Functional complementation experiments:

    • Express DDB_G0281465 homologs from other species in Dictyostelium knockout strains

    • Assess rescue of phenotypes through quantitative assays

    • Create chimeric proteins with domains from different species to map functional regions

  • Expression context analysis:

    • Compare expression patterns during development across species

    • Identify conserved transcription factor binding sites in promoter regions

    • Analyze conservation of protein-protein interaction networks

What are the most promising approaches to elucidate the specific function of DDB_G0281465 in membrane dynamics?

The most promising approaches to elucidate DDB_G0281465's specific function in membrane dynamics include:

  • CRISPR-Cas9 genome editing:

    • Generate precise knockout and knock-in mutants

    • Create conditional expression systems using inducible promoters

    • Introduce specific point mutations to disrupt predicted functional domains

  • High-resolution membrane imaging:

    • Implement super-resolution microscopy techniques (STORM, PALM, STED)

    • Use correlative light and electron microscopy (CLEM) to visualize membrane ultrastructure

    • Apply expansion microscopy to enhance spatial resolution

  • Membrane biophysics approaches:

    • Measure membrane fluidity changes in DDB_G0281465 mutants using fluorescence anisotropy

    • Quantify lipid domain organization using FRET between domain-specific probes

    • Analyze membrane mechanical properties using atomic force microscopy

  • Protein-lipid interaction analysis:

    • Perform lipidomics analysis comparing wild-type and mutant cells

    • Use lipid overlay assays to identify specific lipid-binding properties

    • Implement native mass spectrometry to identify bound lipids

  • Integrative multi-omics analysis:

    • Combine proteomics, transcriptomics, and lipidomics data

    • Apply machine learning algorithms to identify functional patterns

    • Model protein function in the context of broader signaling networks

The field model of membrane organization in Dictyostelium suggests that transmembrane proteins experience different membrane viscosity regions, which significantly impacts their diffusion properties . Investigation of how DDB_G0281465 interacts with these different membrane regions could provide crucial insights into its function.

How might environmental stress conditions affect DDB_G0281465 expression and function?

Environmental stress likely impacts DDB_G0281465 expression and function in multiple ways:

  • Starvation response:

    • Starvation in Dictyostelium induces polyP accumulation and reduces membrane fluidity

    • Design experiments to monitor DDB_G0281465 expression during starvation using RT-qPCR and western blotting

    • Assess membrane localization changes during starvation using confocal microscopy

    • Compare macropinocytosis, exocytosis, and phagocytosis rates between wild-type and DDB_G0281465-mutant cells under starvation

  • Osmotic stress:

    • Subject cells to hyperosmotic and hypoosmotic conditions

    • Monitor protein localization changes using fluorescence microscopy

    • Measure membrane integrity using dye exclusion assays

    • Assess cytoskeletal reorganization in response to osmotic stress

  • Oxidative stress:

    • Expose cells to hydrogen peroxide or paraquat

    • Measure reactive oxygen species (ROS) levels using fluorescent probes

    • Analyze protein oxidation state using redox proteomics

    • Determine if DDB_G0281465 contains redox-sensitive domains

  • Temperature stress:

    • Vary culture temperature to alter membrane fluidity

    • Measure diffusion coefficients at different temperatures

    • Analyze expression changes using qPCR and western blotting

    • Compare heat shock response between wild-type and mutant cells

  • Research design table for stress experiments:

Stress TypeTreatment ConditionsKey Parameters to MeasureTechnical Approaches
StarvationDB buffer, 0-12hPolyP levels, membrane fluidityFRAP, fluorescent polyP dyes
Osmotic±100-400 mOsmVolume change, protein localizationConfocal microscopy, flow cytometry
Oxidative0.1-1 mM H₂O₂ROS levels, protein oxidationCM-H₂DCFDA fluorescence, mass spectrometry
Temperature15-30°CDiffusion coefficient, expressionSingle-molecule tracking, qPCR

What potential role might DDB_G0281465 play in developmental signaling pathways?

DDB_G0281465 may function in developmental signaling pathways, particularly during early differentiation triggered by starvation and cAMP signaling in Dictyostelium:

  • Relationship with cAMP signaling:

    • Determine if DDB_G0281465 expression changes upon cAMP pulsing, as observed for other developmentally regulated proteins

    • Analyze protein phosphorylation state before and after cAMP stimulus using phosphoproteomics

    • Investigate potential interaction with components of the cAMP signaling pathway (receptors, G proteins, adenylyl cyclase)

    • Measure cAMP-induced calcium flux in wild-type versus knockout cells

  • Developmental transition regulation:

    • Monitor expression throughout the Dictyostelium life cycle using time-course proteomics and transcriptomics

    • Analyze developmental phenotypes in knockout strains

    • Implement lineage tracing to determine cell fate specification in chimeric organisms

  • Integration with GSK-3 signaling:

    • Investigate interaction with GlkA (GSK-3 kinase), which is implicated in substrate adhesion and chemotaxis

    • Compare DDB_G0281465 expression between wild-type and glkA-null cells

    • Analyze potential phosphorylation by GlkA using in vitro kinase assays

    • Perform epistasis analysis by generating double mutants

  • Cell adhesion and motility regulation:

    • Assess changes in cell-substrate adhesion using reflection interference contrast microscopy

    • Quantify cell motility parameters using computer-assisted tracking

    • Measure chemotactic efficiency toward cAMP gradients

    • Analyze cytoskeletal dynamics using live-cell imaging of fluorescently labeled actin

  • Gene regulatory networks:

    • Identify transcription factors regulating DDB_G0281465 expression

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) to map binding sites

    • Use gene regulatory network modeling to position DDB_G0281465 within developmental pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.