Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0281883 (DDB_G0281883)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
DDB_G0281883; Putative uncharacterized transmembrane protein DDB_G0281883
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0281883
Target Protein Sequence
MKKKKEKEKEKQKSINYYIFFFQYTLVYNTIQINKIYKLFYHVFITKKKNYFSKSNYNSP PKSVFSSGRENVYLPEEYKKKIEKENQENLEILENSMKDASHSKTTSLPFSSSSPQSSSS SSSSSSSSNSSLSCSLIFSSTLSLIKSELIKDDTIKYSESDSKSDSEFDSESNSDFDSES ESEYEYEYEYESKSNSEQPIINNYLDHTYIYNFAIVVKAIHYLHHFIKEMLKFV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism?

Dictyostelium discoideum is a social amoeba that offers unique advantages as a model organism for cellular and molecular biology research. Its life cycle comprises both unicellular growth and a 24-hour multicellular developmental phase with distinct stages, allowing for rapid detection of developmental phenotypes . The fully sequenced, haploid genome of D. discoideum provides a less complex system to work with while maintaining many genes and signaling pathways found in more complex eukaryotes . This model organism is particularly valuable because researchers can introduce one or multiple gene disruptions with relative ease, and gene function can be studied in a true multicellular context with measurable phenotypic outcomes .

What are the predicted structural characteristics of the DDB_G0281883 transmembrane protein?

Based on computational analyses, DDB_G0281883 is characterized as a putative transmembrane protein with multiple predicted membrane-spanning domains. Researchers typically employ bioinformatics tools such as TMHMM, Phobius, or TOPCONS to predict transmembrane regions, followed by structural prediction algorithms like AlphaFold2 to generate three-dimensional models . For uncharacterized proteins like DDB_G0281883, these computational approaches provide initial insights into protein topology, potential functional domains, and structural characteristics that guide subsequent experimental designs.

What expression methods are most effective for recombinant production of DDB_G0281883?

For transmembrane proteins from Dictyostelium, researchers typically employ a combination of expression systems. E. coli-based expression is often attempted first due to its simplicity, but for many transmembrane proteins, eukaryotic expression systems like yeast (P. pastoris), insect cells (using baculovirus), or mammalian cell lines often yield better results with proper folding and post-translational modifications. The methodological approach should include:

  • Vector selection with appropriate purification tags (His, GST, or MBP)

  • Codon optimization for the expression host

  • Testing of expression conditions (temperature, induction parameters, culture media)

  • Solubilization screening using different detergents (DDM, LMNG, or GDN)

  • Purification protocol optimization using affinity chromatography followed by size exclusion chromatography

How can researchers verify the subcellular localization of DDB_G0281883 in Dictyostelium cells?

Determining the subcellular localization of DDB_G0281883 requires a multi-method approach:

  • Fluorescent protein tagging: Generate constructs expressing DDB_G0281883 fused to GFP, mCherry, or other fluorescent proteins, taking care to place tags where they minimally disrupt protein function .

  • Immunofluorescence microscopy: Develop antibodies against DDB_G0281883 or use epitope tags for immunodetection.

  • Subcellular fractionation: Separate cellular components biochemically, followed by Western blotting to detect the protein in specific fractions.

  • Co-localization studies: Use established markers for cellular compartments (endoplasmic reticulum, Golgi, plasma membrane, endosomes) to determine precise localization.

This methodological workflow allows researchers to confirm transmembrane localization predictions and gain insights into potential function based on cellular distribution.

What approaches can be used to characterize the function of DDB_G0281883 through CRISPR-Cas9 gene editing?

CRISPR-Cas9 technology has been successfully adapted for use in Dictyostelium, as noted in research by Yamashita et al. . For characterizing DDB_G0281883 function, researchers should consider:

  • gRNA design: Target sequences with minimal off-target effects, preferably in early exons or critical domains

  • Delivery methods: Electroporation protocols optimized for Dictyostelium

  • Selection strategies: Using appropriate selection markers (e.g., Blasticidin)

  • Knockout validation: PCR genotyping, Western blotting, and phenotypic assays

  • Phenotypic analysis: Examining effects on growth, development, chemotaxis, phagocytosis, and stress responses

For more nuanced functional studies, consider:

  • Conditional knockouts using inducible systems

  • Domain-specific mutations rather than complete knockouts

  • Complementation studies with wildtype or mutant versions

  • CRISPR interference (CRISPRi) for temporary knockdown

How can researchers identify protein-protein interactions involving DDB_G0281883?

For transmembrane proteins like DDB_G0281883, standard interaction detection methods must be modified. A comprehensive approach includes:

  • Co-immunoprecipitation (Co-IP): Using either antibodies against DDB_G0281883 or epitope tags with appropriate detergent solubilization . This technique has been successfully used to detect protein-protein interactions in Dictyostelium, as demonstrated in studies of other transmembrane proteins .

  • Proximity labeling methods: BioID or APEX2 fusions to label proteins in proximity to DDB_G0281883 in living cells, followed by purification and mass spectrometry.

  • Split-protein complementation assays: Using split-GFP, split-luciferase, or other complementation systems to detect interactions in vivo.

  • Yeast two-hybrid membrane systems: Modified for transmembrane protein analysis.

  • Cross-linking mass spectrometry: To capture transient or weak interactions.

MethodAdvantagesLimitationsBest For
Co-IPDetects native complexesRequires good antibodies or tagsStable interactions
Proximity labelingIn vivo, detects transient interactionsPotential false positivesMembrane protein neighborhoods
Split complementationIn vivo visualizationMay affect protein foldingBinary interaction validation
Y2H membraneHigh-throughputHigh false positive/negative ratesInitial screening
XL-MSCaptures direct interactionsComplex data analysisInteraction interfaces

How does the expression of DDB_G0281883 change during Dictyostelium's developmental cycle?

To characterize the expression profile of DDB_G0281883 throughout Dictyostelium's developmental cycle, researchers should employ:

  • Quantitative RT-PCR: Measure mRNA levels at different developmental time points (0h, 4h, 8h, 12h, 16h, 20h, 24h), corresponding to key stages shown in Figure 1A from the Frontiers article .

  • RNA-seq analysis: For transcriptome-wide comparisons across developmental stages.

  • Western blotting: To track protein levels throughout development, using either specific antibodies or tagged versions of the protein.

  • Promoter-reporter fusions: Fusing the DDB_G0281883 promoter to a reporter gene like GFP or luciferase to visualize expression patterns in real-time during development.

  • Single-cell RNA-seq: To determine if expression varies among cell types during the multicellular phase.

These methods would allow researchers to determine if DDB_G0281883 is constitutively expressed or regulated during specific developmental stages, providing clues to its function.

What approaches can resolve contradictory data regarding DDB_G0281883 function?

When faced with contradictory data about DDB_G0281883 function, researchers should implement the following systematic approach:

  • Methodological validation:

    • Verify knockout/knockdown efficiency using multiple methods

    • Confirm antibody specificity with appropriate controls

    • Test expression constructs for correct protein production

  • Independent replication:

    • Use different clonal lines

    • Employ alternative techniques to measure the same phenotype

    • Collaborate with other laboratories for unbiased verification

  • Conditional approaches:

    • Test function under different growth conditions

    • Examine phenotypes across developmental stages

    • Use inducible systems to control expression timing

  • Genetic interaction studies:

    • Perform epistasis analysis with related genes

    • Create double knockout strains

    • Conduct suppressor screens to identify genetic modifiers

  • Reconciliation analysis:

    • Determine if contradictions are context-dependent

    • Consider post-translational modifications affecting function

    • Explore potential redundant or compensatory mechanisms

What are the optimal conditions for solubilizing and purifying recombinant DDB_G0281883?

Transmembrane protein solubilization and purification require systematic optimization. For DDB_G0281883, researchers should consider:

  • Detergent screening panel:

Detergent ClassExamplesStarting Concentration
MaltosidesDDM, UDM1%
Neopentyl glycolsLMNG, GDN0.1-0.5%
Fos-cholinesFC-12, FC-140.1-1%
Steroid-basedDigitonin, CHS0.1-1%
  • Solubilization protocol:

    • Membrane preparation (osmotic shock or mechanical disruption)

    • Buffer composition (pH 7.5-8.0, 150-300 mM NaCl)

    • Solubilization time (2-16 hours) and temperature (4°C)

    • Inclusion of protease inhibitors

  • Purification strategy:

    • Initial capture using affinity chromatography (His-tag, GST)

    • Secondary purification by ion exchange or size exclusion

    • Critical evaluation of protein homogeneity via SDS-PAGE and Western blotting

    • Functional verification through activity assays or ligand binding studies

  • Alternative approaches:

    • Amphipol or SMA copolymer solubilization

    • Nanodiscs or liposome reconstitution

    • Detergent-free extraction methods

How can researchers distinguish between direct and indirect effects in DDB_G0281883 knockout phenotypes?

Distinguishing direct from indirect effects in knockout studies requires multiple complementary approaches:

  • Rescue experiments:

    • Re-expression of wildtype DDB_G0281883 in knockout strains

    • Domain-specific mutants to identify critical functional regions

    • Controlled expression levels using inducible promoters

  • Acute interference:

    • CRISPRi for rapid, reversible knockdown

    • Auxin-inducible degron tagging for protein depletion

    • Small molecule inhibitors if binding sites are known

  • Temporal analysis:

    • Time-course studies following knockout/knockdown

    • Identification of primary vs. secondary effects based on temporal sequence

    • Tracking of immediate transcriptional/proteomic changes

  • Pathway dissection:

    • Analysis of known upstream and downstream factors

    • Phosphoproteomic analysis to identify signaling changes

    • Epistasis testing with related genes

  • Complementation with homologs:

    • Testing if homologs from other species can rescue function

    • Domain swapping to identify functional regions

What quality control metrics should be applied when studying the recombinant DDB_G0281883 protein?

Rigorous quality control is essential for studying recombinant transmembrane proteins like DDB_G0281883:

  • Purity assessment:

    • SDS-PAGE with Coomassie/silver staining (>90% purity)

    • Western blotting with protein-specific or tag antibodies

    • Mass spectrometry for protein identification and contamination analysis

  • Structural integrity:

    • Circular dichroism to verify secondary structure content

    • Thermal stability assays (TSA/DSF) to assess folding

    • Limited proteolysis to evaluate domain organization

    • Native PAGE or size exclusion chromatography to assess oligomeric state

  • Functionality verification:

    • Ligand binding assays if potential ligands are identified

    • Activity assays if enzymatic function is predicted

    • Reconstitution in liposomes to verify membrane insertion

  • Batch consistency:

    • Lot-to-lot comparison using the metrics above

    • Storage stability assessment under different conditions

    • Freeze-thaw tolerance evaluation

How conserved is DDB_G0281883 across species, and what can this tell us about its function?

Comparative genomics provides valuable insights into potential functions of uncharacterized proteins like DDB_G0281883:

  • Ortholog identification:

    • BLAST searches against multiple organism databases

    • Hidden Markov Model (HMM) profile searches for distant homologs

    • Synteny analysis to identify genomic context conservation

  • Evolutionary analysis:

    • Multiple sequence alignment of orthologs

    • Phylogenetic tree construction to trace evolutionary history

    • Calculation of selection pressure (dN/dS ratios) on different protein regions

  • Domain conservation:

    • Identification of conserved functional domains

    • Mapping of evolutionary conservation onto structural models

    • Analysis of conserved post-translational modification sites

  • Functional inference:

    • Literature review of characterized orthologs

    • Analysis of co-evolution with interacting proteins

    • Identification of conserved binding motifs or active sites

This evolutionary perspective can provide testable hypotheses about DDB_G0281883 function based on its conservation patterns and evolutionary history.

How does the Dictyostelium model for studying DDB_G0281883 compare to other systems for analyzing transmembrane proteins?

Dictyostelium offers distinct advantages for studying transmembrane proteins like DDB_G0281883 compared to other model systems:

Model SystemAdvantagesLimitationsBest Applications
Dictyostelium- Haploid genome for easy genetic manipulation
- Both unicellular and multicellular phases
- Conserved signaling pathways
- Rapid development (24h cycle)
- Some divergence from mammalian systems
- Limited commercial antibodies
- Fewer genetic tools than yeast/bacteria
- Developmental biology
- Cell motility/chemotaxis
- Host-pathogen interactions
- Fundamental membrane processes
Yeast- Extensive genetic toolkit
- Easy cultivation
- Well-established membrane protein expression
- Greater evolutionary distance from mammals
- Different membrane composition
- High-throughput screens
- Protein trafficking studies
- Initial functional characterization
Mammalian cells- Close evolutionary relationship to humans
- Native-like membrane environment
- Extensive molecular tools
- More complex genome (diploid)
- Slower growth
- Higher maintenance costs
- Human disease modeling
- Tissue-specific functions
- Complex signaling studies
Bacterial systems- Rapid growth
- Simple genetics
- High-yield protein production
- Very different membrane architecture
- Limited post-translational modifications
- Structural studies
- Evolutionary analysis
- Basic biochemical characterization

Dictyostelium's unique position as a eukaryotic organism with both unicellular and multicellular phases makes it particularly valuable for studying transmembrane proteins involved in processes like chemotaxis, phagocytosis, and intercellular communication .

How might research on DDB_G0281883 inform studies of related human transmembrane proteins and associated diseases?

Dictyostelium has emerged as a valuable biomedical model system for studying human diseases . For uncharacterized transmembrane proteins like DDB_G0281883, research may have translational implications through:

  • Identification of human orthologs or proteins with similar domains, which may be implicated in disease.

  • Characterization of conserved signaling pathways that regulate cell behavior similar to those observed in mammalian cells .

  • Discovery of fundamental mechanisms in membrane protein function that apply across species.

  • Development of research methods applicable to studying human membrane proteins.

If DDB_G0281883 exhibits functions related to processes that are dysregulated in human disease (e.g., cell motility in cancer metastasis, phagocytosis in immune disorders, or membrane trafficking in neurodegeneration), the findings could have direct biomedical relevance.

What high-throughput screening approaches could identify small molecules targeting DDB_G0281883?

For identifying small molecules that interact with or modulate DDB_G0281883 function, researchers could employ:

  • Phenotypic screening:

    • Using DDB_G0281883 knockout or overexpression strains

    • Monitoring development, chemotaxis, or other relevant phenotypes

    • Insertional mutant libraries to enhance pharmacogenetic screens

  • Target-based approaches:

    • Thermal shift assays to detect ligand binding

    • Surface plasmon resonance or microscale thermophoresis with purified protein

    • Fluorescence-based binding assays

  • Computational methods:

    • Virtual screening against structural models

    • Molecular docking of compound libraries

    • Fragment-based drug design

  • Functional assays:

    • If transport function is suspected, transport assays

    • If enzymatic activity is identified, activity-based screens

    • Protein-protein interaction modulation screens

The insertional mutant libraries that have been used to facilitate pharmacogenetic screens in Dictyostelium provide a powerful platform for identifying bioactive compounds and understanding their function at a cellular level .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.