Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0285049 (DDB_G0285049)

Shipped with Ice Packs
In Stock

Description

Identification and Classification

DDB_G0285049 is a predicted transmembrane protein encoded by the DDB_G0285049 gene in Dictyostelium discoideum. Key identifiers include:

  • UniProt Accession: Q54P08

  • NCBI GeneID: 8624821

  • Sequence Length: 370 amino acids (full-length)

  • Molecular Weight: ~42,991 Da (calculated)

The protein is annotated as "uncharacterized" due to limited functional studies, though bioinformatic analyses suggest transmembrane domains. Its recombinant form is expressed in E. coli or cell-free systems for research purposes .

Functional Hypotheses

While no direct experimental data links DDB_G0285049 to specific pathways, transmembrane proteins in Dictyostelium often participate in:

  • Signal Transduction: G-protein coupled receptors or ion channels .

  • Membrane Trafficking: Endocytosis or exocytosis .

  • Pathogen Interaction: Phagosome formation or bacterial recognition .

These hypotheses align with the broader roles of transmembrane proteins in cellular homeostasis and stress responses .

Experimental Uses

  • ELISA Assays: Detects DDB_G0285049 in solution using anti-His or anti-tag antibodies .

  • Functional Screens: Testing ion channel activity or ligand binding in artificial membranes (e.g., lipid bilayers) .

  • Structural Studies: Crystallization or cryo-EM to resolve transmembrane domain architecture .

Challenges

  • Limited Biochemical Data: No characterized binding partners or enzymatic activity reported .

  • Expression Variability: Recombinant forms may require optimization for solubility or activity .

Transmembrane Protein Families

FeatureDDB_G0285049General Plant TMEMs
DomainDUF726GPCR, ion channels, transporters
FunctionUnknownSignal transduction, stress response
LocalizationPlasma membranePlasma membrane, organelles

Note: DUF726 is a domain of unknown function, highlighting the need for further characterization.

Open Questions and Future Directions

  1. Functional Annotation: Knockout or RNAi studies in Dictyostelium to assess developmental or pathogen-response phenotypes .

  2. Structural Determination: X-ray crystallography or NMR to resolve domain interactions.

  3. Pathway Integration: Co-IP or yeast two-hybrid assays to identify interacting proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0285049; Putative uncharacterized transmembrane protein DDB_G0285049
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0285049
Target Protein Sequence
MVFLKVDCSKLFIFLCCIMSITILSFSLVFPYYESDFIIVNHTDIRNNTIVINKEFHQFQ FFGTYFYDINRFEMKTSFNQAYLITKRVSYDSYDSSTKNSVFQIITSMTLTSLIAKVFPI PILIVNMYINLQKPKRRYLNQIQQHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNQNNNNNDNNDNNDVLDGANEVVINTMPTYEVLMERYQSSASYYLITQLVVNGVSFMIT LFSTFVVTHRISITMKLLTSIDEQIFNKPLCYTKNLDPFGYCNSFIGFSSTTSDENFMDF SWGPSFGWYLSLCSLCLDSFSIIVIIFLIITEGKLKKPKQPHKFTNILNLSDMDLINYRL LTLNQRIGTD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Dictyostelium discoideum a suitable model organism for studying transmembrane proteins like DDB_G0285049?

Dictyostelium discoideum offers exceptional advantages as a model system for studying transmembrane proteins due to its unique life cycle and genetic tractability. The organism transitions between unicellular and multicellular states depending on nutrient availability, providing diverse phenotypic "readouts" of underlying cytopathological pathways. When nutrients are abundant, the amoebae remain solitary; upon nutrient deprivation, they release pulses of cAMP, inducing aggregation of approximately 100,000 cells into mounds that subsequently differentiate into multicellular structures . This developmental plasticity makes D. discoideum particularly valuable for studying membrane proteins involved in cell signaling, adhesion, and morphogenesis.

Furthermore, D. discoideum's fully sequenced genome allows for straightforward genetic manipulation of transmembrane proteins like DDB_G0285049. The organism's haploid nature facilitates gene disruption studies, and many cellular processes are highly conserved between D. discoideum and higher eukaryotes, allowing researchers to investigate fundamental membrane protein functions in a simplified system .

How does the structure of DDB_G0285049 compare to similar transmembrane proteins in other model organisms?

The putative uncharacterized transmembrane protein DDB_G0285049 in Dictyostelium discoideum shares structural features with transmembrane proteins found across evolutionary diverse organisms. Detailed structural analysis reveals multiple transmembrane domains characteristic of proteins involved in cellular transport, signaling, or membrane organization.

While specific structural data for DDB_G0285049 remains limited, comparative analysis with other D. discoideum transmembrane proteins suggests potential functional roles. For instance, the protein may exhibit structural similarities to the presenilin protein family members found in D. discoideum (PsenA and PsenB), which contain multiple transmembrane domains and are involved in proteolytic and non-proteolytic cellular functions . Structural homology modeling based on conserved domains indicates potential functional conservation across species, despite sequence divergence.

What experimental approaches are most effective for characterizing the function of uncharacterized transmembrane proteins like DDB_G0285049?

When characterizing uncharacterized transmembrane proteins like DDB_G0285049, a multifaceted experimental approach yields the most comprehensive results. Begin with gene disruption studies using homologous recombination techniques to generate knockout mutants, followed by systematic phenotypic analysis across D. discoideum's developmental stages. The knockout phenotype should be assessed during both unicellular growth and multicellular development, examining parameters such as cell motility, cytokinesis, macropinocytosis, phagocytosis, and development progression.

For more nuanced functional characterization, consider the following methodological sequence:

  • Generate fluorescently tagged versions of DDB_G0285049 (e.g., GFP fusion proteins) to determine subcellular localization

  • Perform co-immunoprecipitation studies followed by mass spectrometry to identify protein interaction partners

  • Conduct rescue experiments with site-directed mutants to identify critical functional domains

  • Implement complementation studies using human orthologs to assess functional conservation

This approach has proven successful in characterizing other D. discoideum transmembrane proteins, such as the presenilin proteins, which were localized to the endoplasmic reticulum through fluorescent tagging techniques .

How should I design time-series experiments to study DDB_G0285049 expression during Dictyostelium development?

When designing time-series experiments to study DDB_G0285049 expression during Dictyostelium development, implement a quasi-experimental time-series design that captures protein expression across all developmental stages. This approach allows you to detect significant changes in expression patterns that correlate with specific developmental transitions.

The experimental protocol should follow these steps:

  • Synchronize development by plating axenically grown cells on non-nutrient agar at a density of 5 × 10^7 cells/cm^2

  • Collect samples at specific timepoints covering the entire 24-hour developmental cycle:

    • 0h (vegetative cells)

    • 4h (early aggregation)

    • 8h (tight aggregate formation)

    • 12h (tipped mound)

    • 16h (first finger/slug stage)

    • 20h (early culmination)

    • 24h (mature fruiting body)

  • Extract RNA for RT-qPCR analysis or protein for Western blotting at each timepoint

  • Include appropriate housekeeping genes or proteins as internal controls

When analyzing the resultant time-series data, apply statistical approaches that account for the autocorrelation inherent in time-series measurements. The time-series experimental design provides a robust framework for evaluating expression patterns across developmental stages while controlling for potential confounding variables.

What protein expression systems are optimal for producing recombinant DDB_G0285049 for biochemical studies?

For optimal expression of recombinant DDB_G0285049, a hierarchical approach testing multiple expression systems is recommended, as transmembrane proteins often present challenges for heterologous expression. The methodological strategy should prioritize systems in this order:

  • Dictyostelium discoideum expression system: Utilizing the native organism provides the most authentic post-translational modifications and membrane environment. Construct an expression vector with the actin15 promoter for constitutive expression or the discoidin promoter for inducible expression. Include a C-terminal or N-terminal affinity tag (His6 or FLAG) for purification, ensuring the tag doesn't interfere with transmembrane domains.

  • Mammalian expression systems: HEK293 or CHO cells often yield properly folded eukaryotic transmembrane proteins. Use strong promoters like CMV with optimized signal sequences.

  • Insect cell expression: Baculovirus expression systems provide a eukaryotic environment with high expression levels.

  • Cell-free expression systems: Recent advances in cell-free systems supplemented with lipid nanodiscs or detergent micelles have improved transmembrane protein expression.

For each system, optimize expression conditions using a small-scale expression matrix varying:

  • Induction conditions

  • Temperature (lowering to 16-20°C often improves proper folding)

  • Time of expression

  • Detergent screening for extraction (test a panel of 8-10 detergents)

Purification should employ a two-step approach combining affinity chromatography with size exclusion chromatography. For functional studies, reconstitution into proteoliposomes or nanodiscs maintains native-like lipid environments.

What are the most effective methods for studying protein-protein interactions involving DDB_G0285049?

For investigating protein-protein interactions involving transmembrane proteins like DDB_G0285049, a complementary multi-method approach is essential to overcome the technical challenges associated with membrane protein complexes.

Proximity-based in vivo labeling techniques:
BioID or TurboID fusion constructs with DDB_G0285049 enable the biotinylation of proximal proteins in living D. discoideum cells. These methods are particularly valuable for capturing transient or weak interactions in the native cellular environment. After expression of the fusion protein, biotinylated proteins are isolated using streptavidin affinity purification and identified by mass spectrometry.

Co-immunoprecipitation with crosslinking:
For transmembrane proteins, standard co-immunoprecipitation often disrupts important interactions. Implement a protocol using membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate)) prior to cell lysis. Use gentle detergents like digitonin or DDM that preserve membrane protein complexes during solubilization.

Split-protein complementation assays:
Techniques such as bimolecular fluorescence complementation (BiFC) or split-luciferase assays can visualize interactions in living cells. These methods involve fusing potential interaction partners with complementary fragments of a reporter protein that reconstitutes function when brought into proximity.

Analytical ultracentrifugation and size exclusion chromatography:
For purified proteins, these techniques provide quantitative information on complex formation and stoichiometry under near-native conditions in detergent micelles or nanodiscs.

When validating interactions, prioritize confirming physiological relevance through techniques like FRET/FLIM microscopy to demonstrate co-localization and interaction in the native cellular context.

How should I analyze transcriptomic data to identify genes co-regulated with DDB_G0285049?

When analyzing transcriptomic data to identify genes co-regulated with DDB_G0285049, implement a systematic bioinformatics pipeline that incorporates both correlation-based and network-based approaches:

  • Data preprocessing and normalization:

    • Perform robust quality control including removal of low-quality reads

    • Apply appropriate normalization methods (e.g., TPM, RPKM, or quantile normalization)

    • Transform data if necessary to achieve approximate normal distribution

  • Correlation analysis:

    • Calculate Pearson or Spearman correlation coefficients between DDB_G0285049 and all other genes

    • Apply a stringent statistical threshold (adjusted p-value < 0.01)

    • Generate correlation matrices for visualization

  • Weighted gene co-expression network analysis (WGCNA):

    • Construct co-expression networks to identify modules of highly interconnected genes

    • Calculate module membership to determine which module contains DDB_G0285049

    • Identify hub genes within the same module as potential key regulators

  • Time-series analysis (for developmental data):

    • Apply specific time-series clustering algorithms (e.g., Short Time-series Expression Miner)

    • Identify genes with similar temporal expression patterns during development

  • Functional enrichment analysis:

    • Perform GO term and pathway enrichment analysis on co-regulated gene sets

    • Use Dictyostelium-specific annotation databases for more accurate interpretation

When interpreting results, prioritize genes that consistently appear across multiple analytical approaches, and validate key co-expression relationships using RT-qPCR or reporter constructs.

What statistical approaches should I use when analyzing phenotypic data from DDB_G0285049 knockout experiments?

When analyzing phenotypic data from DDB_G0285049 knockout experiments, apply appropriate statistical methodologies based on the experimental design and data characteristics:

For quantitative phenotypic assays (growth rates, cell motility, development timing):

  • Start with data exploration using visualization techniques to identify patterns and potential outliers

  • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • For normally distributed data, apply parametric tests (t-test for two groups, ANOVA for multiple groups)

  • For non-normal data, use non-parametric alternatives (Mann-Whitney U or Kruskal-Wallis)

  • When comparing multiple experimental conditions, correct for multiple comparisons using Bonferroni or false discovery rate methods

For developmental phenotypes across time points:

  • Implement repeated measures ANOVA or mixed-effects models that account for the non-independence of observations over time

  • Consider time-series analysis techniques to characterize developmental trajectories

  • Apply quasi-experimental time-series designs that control for history and maturation threats to validity

For complex phenotypic data (multicellular morphology, subcellular localization):

  • Develop quantitative scoring systems to reduce observer bias

  • Use blinded scoring by multiple observers to establish inter-rater reliability

  • Apply appropriate non-parametric tests for categorical data

Sample size determination should be based on power analysis, with most D. discoideum phenotypic experiments requiring at least 3-5 biological replicates and 2-3 technical replicates per condition to achieve statistical power ≥0.8 at α=0.05.

How can I use D. discoideum DDB_G0285049 to model human disease-associated transmembrane proteins?

Leveraging Dictyostelium discoideum DDB_G0285049 to model human disease-associated transmembrane proteins requires a strategic comparative biology approach. The methodology centers on establishing functional homology between DDB_G0285049 and human disease proteins through complementation studies and domain function analysis.

Begin by identifying potential human orthologs through sequence similarity searches and structural prediction algorithms. Once candidate human proteins are identified, implement a substitution strategy where you express the human protein in a DDB_G0285049 knockout background to assess functional rescue. This approach has been successfully demonstrated with presenilin proteins, where human Psen1 expression rescued developmental phenotypes in D. discoideum presenilin mutants .

For specific disease modeling applications:

  • Generate D. discoideum DDB_G0285049 variants containing mutations equivalent to disease-associated mutations in the human ortholog

  • Characterize the cellular consequences using high-content phenotypic profiling

  • Develop compound screening assays in the mutant background to identify potential therapeutic molecules

This approach is particularly valuable because D. discoideum provides a simplified cellular environment for studying fundamental protein functions while maintaining conserved cellular processes relevant to disease pathology. D. discoideum has already proven valuable for studying neurodegenerative disease mechanisms, despite lacking a central nervous system, due to conserved cellular processes like mitochondrial function and lysosomal activity .

What advanced imaging techniques are most informative for studying the dynamics of DDB_G0285049 localization and trafficking?

For studying the dynamics of DDB_G0285049 localization and trafficking, implement a multi-scale imaging approach that captures both spatial and temporal dimensions of protein behavior in living cells:

Super-resolution microscopy techniques:

  • Structured Illumination Microscopy (SIM) achieves ~100 nm resolution, suitable for examining DDB_G0285049 distribution within membrane compartments

  • Stochastic Optical Reconstruction Microscopy (STORM) or Photoactivated Localization Microscopy (PALM) provide ~20 nm resolution for precise localization studies

  • Stimulated Emission Depletion (STED) microscopy enables live-cell super-resolution imaging of protein dynamics

4D live-cell imaging methodologies:

  • Spinning disk confocal microscopy with environmental chambers for long-term (4-6 hour) imaging during D. discoideum development

  • Implement photo-switchable fluorescent protein tags (like mEos or Dendra2) for pulse-chase imaging to track protein cohorts over time

  • For quantitative trafficking studies, use photobleaching approaches such as FRAP (Fluorescence Recovery After Photobleaching) to measure mobility and residency times within specific compartments

Correlative Light and Electron Microscopy (CLEM):
Combine fluorescence imaging of tagged DDB_G0285049 with electron microscopy to place the protein within the ultrastructural context of membrane compartments and organelles.

Multi-channel imaging:
Simultaneously visualize DDB_G0285049 with markers for specific organelles (ER, Golgi, endosomes) using spectrally distinct fluorophores to track dynamic associations during trafficking events.

Data processing should employ computational approaches including:

  • Deconvolution algorithms to enhance resolution

  • Automated tracking algorithms to follow protein movement

  • Quantitative co-localization analysis using object-based methods rather than simple pixel correlation

What strategies can resolve expression difficulties when working with recombinant DDB_G0285049?

When encountering expression challenges with recombinant DDB_G0285049, implement a systematic troubleshooting approach addressing the unique difficulties of transmembrane proteins:

Expression vector optimization:

  • Modify the signal sequence to enhance membrane targeting

  • Test multiple affinity tag positions (N-terminal, C-terminal, or internal flexible loops)

  • Introduce fusion partners that enhance folding (e.g., MBP, SUMO)

  • Design constructs with truncated versions removing problematic domains while retaining key functional regions

Expression conditions matrix:
Systematically test combinations of:

  • Temperature (37°C, 30°C, 25°C, 18°C)

  • Induction strength (varying IPTG/inducer concentrations)

  • Expression duration (3h, 6h, 12h, 24h)

  • Media composition (standard, enhanced, minimal)

Solubilization screening:
For membrane proteins, detergent selection is critical. Test a panel including:

  • Mild detergents (DDM, LMNG, Digitonin)

  • Harsh detergents (LDAO, OG, Triton X-100)

  • Novel amphipathic polymers (SMALPs, amphipols)

  • Detergent mixtures that mimic native membrane environments

Co-expression strategies:
Express DDB_G0285049 with potential binding partners or chaperones to enhance stability and folding:

  • General chaperones (GroEL/ES system)

  • Membrane-specific chaperones

  • Putative interacting proteins identified in preliminary studies

For each optimization step, implement small-scale expression tests with efficient detection methods (fluorescence or Western blotting) before scaling up. Maintain detailed records of all conditions tested to identify patterns in successful versus failed expressions.

How can I optimize immunoprecipitation protocols specifically for DDB_G0285049?

Optimizing immunoprecipitation protocols for transmembrane proteins like DDB_G0285049 requires carefully balancing membrane solubilization with preservation of protein-protein interactions. The following methodological framework addresses the specific challenges:

Cell lysis and membrane protein extraction optimization:

  • Test a gradient of detergent concentrations using initially mild detergents:

    • Digitonin (0.5-2%)

    • n-Dodecyl-β-D-maltoside (DDM) (0.5-1%)

    • CHAPS (0.5-1%)

  • Prepare lysis buffers with protective additives:

    • Protease inhibitor cocktail (broad spectrum)

    • Phosphatase inhibitors if studying phosphorylation states

    • Reducing agents (5 mM DTT or 1 mM TCEP)

    • Glycerol (10%) to stabilize protein structure

Antibody selection and immobilization strategy:

  • For tagged constructs, compare:

    • Direct capture with anti-tag antibody-conjugated beads

    • Biotinylated antibodies with streptavidin supports

    • Two-step protocols with primary antibody followed by Protein A/G

  • For native protein immunoprecipitation:

    • Generate and characterize multiple antibodies targeting different epitopes

    • Test monoclonal versus polyclonal antibodies

    • Validate antibody specificity using knockout controls

Binding and washing conditions matrix:

  • Systematically test combinations of:

    • Binding time (1h, 2h, 4h, overnight)

    • Temperature (4°C, room temperature)

    • Buffer ionic strength (150-500 mM NaCl)

    • Detergent concentration in wash buffers (typically 0.1-0.5× lysis concentration)

  • Consider mild crosslinking approaches:

    • DSP (dithiobis(succinimidyl propionate)) at low concentrations (0.1-0.5 mM)

    • Formaldehyde crosslinking (0.1-0.3%)

    • Photoactivatable crosslinkers for specific interaction stabilization

Elution strategy optimization:

  • For affinity-tagged proteins:

    • Competitive elution with tag peptide

    • Specific protease cleavage at engineered sites

    • pH gradient elution

  • For antibody-based immunoprecipitation:

    • Low pH glycine buffers (pH 2.5-3.0) with immediate neutralization

    • High pH triethylamine buffers (pH 11.0-11.5)

    • SDS sample buffer for maximum recovery but harshest conditions

Document each optimization step with Western blot analysis to track improvements in yield and purity.

How can CRISPR-Cas9 genome editing be applied to study DDB_G0285049 function in Dictyostelium discoideum?

CRISPR-Cas9 genome editing offers powerful approaches for investigating DDB_G0285049 function in Dictyostelium discoideum, enabling precise genetic manipulations beyond traditional knockout methods. Implementation requires D. discoideum-specific optimizations due to its high A/T content genome and unique molecular biology.

For CRISPR-Cas9 editing of DDB_G0285049, follow this methodological workflow:

  • sgRNA design considerations:

    • Select target sites with minimal off-target effects using D. discoideum-specific algorithms

    • Prioritize targets within the first few exons to ensure complete loss-of-function

    • Design multiple sgRNAs (3-4) targeting different regions to maximize success

    • Validate sgRNA efficiency using in vitro cleavage assays before cellular implementation

  • Delivery method optimization:

    • Electroporation of ribonucleoprotein complexes (preassembled Cas9 protein + sgRNA)

    • Transient expression vectors using D. discoideum-specific strong promoters (act15)

    • Inducible Cas9 expression systems for temporal control

  • Advanced genomic modifications:

    • Precise point mutations to create specific variants (using single-stranded DNA repair templates)

    • In-frame insertion of epitope or fluorescent tags for endogenous protein labeling

    • Conditional alleles using loxP sites flanking critical exons

    • Base editing approaches for introducing specific amino acid changes without double-strand breaks

  • Validation and characterization strategies:

    • PCR-based genotyping and Sanger sequencing of edited regions

    • Western blotting to confirm altered protein expression

    • RNA-seq to identify potential compensatory mechanisms activated in response to DDB_G0285049 modification

    • Phenotypic analysis across development and stress conditions

The most significant advantage of CRISPR-Cas9 editing is the ability to create precise mutations that mimic human disease variants or test specific domain functions, moving beyond the binary information provided by complete gene knockouts.

What approaches can integrate structural biology with functional studies of DDB_G0285049?

Integrating structural biology with functional studies of DDB_G0285049 provides comprehensive insights into structure-function relationships of this transmembrane protein. This integration requires methodological approaches spanning multiple scales and techniques:

Membrane protein structural determination approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Purify DDB_G0285049 in detergent micelles, nanodiscs, or amphipols

    • Optimize sample vitrification conditions for transmembrane proteins

    • Collect high-resolution data using direct electron detectors

    • Apply specialized image processing for membrane proteins

  • X-ray crystallography with lipidic cubic phase:

    • Screen crystallization conditions using LCP robotics platforms

    • Implement surface engineering strategies to enhance crystallizability

    • Utilize microcrystallography at synchrotron microfocus beamlines

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Domain-by-domain approach for soluble regions

    • Solid-state NMR for transmembrane domain structure

Structure-guided functional studies:

  • Site-directed mutagenesis informed by structural data:

    • Target conserved residues in predicted functional sites

    • Create a panel of mutants with substitutions designed to test specific structural hypotheses

    • Express mutants in DDB_G0285049-null cells and assess function

  • Molecular dynamics simulations:

    • Perform all-atom MD simulations of DDB_G0285049 in explicit lipid bilayers

    • Analyze conformational changes, lipid interactions, and potential ligand binding sites

    • Generate testable hypotheses about protein dynamics

  • Cross-linking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to capture protein conformations and interactions

    • Identify crosslinked peptides using specialized MS/MS workflows

    • Generate distance constraints to validate computational models

Structure-function validation through interdisciplinary approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map solvent accessibility and conformational dynamics

    • Compare wild-type and mutant proteins to identify differential flexibility

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Introduce spin labels at strategic positions based on structural models

    • Measure distances between labeled sites to validate structural hypotheses

  • Single-molecule FRET:

    • Design fluorophore pairs for key structural elements

    • Monitor conformational changes under different conditions or mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.