Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0285229 (DDB_G0285229)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0285229; Putative uncharacterized transmembrane protein DDB_G0285229
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0285229
Target Protein Sequence
MNNLITENQNLNIKDQICEIEIKNTIVFNKNNINNNNNNNSNSSIKKCLKSSFNESINEN NILTFEIQPNGTYKNYFSNEIPNEIQHLIVEEELYKQFIVKINNKRLPIYYQIMLILMIL SMILIIPLFFIVFTFSPRLAFGICLTLLFYIAIFILTNGLIEKRIVLILTYFVLYKKKNY KIEEIILNYNSFLINKKIPILFRLIYKENHVVPGFDKISIEVTFINE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characterization of DDB_G0285229?

DDB_G0285229 is a putative uncharacterized transmembrane protein from Dictyostelium discoideum with a full protein length of 227 amino acids. It is available as a recombinant protein with a His-tag for research purposes . As a transmembrane protein, it likely contains alpha-helical domains that span the plasma membrane, consistent with other characterized transmembrane proteins in D. discoideum .

To characterize this protein, researchers typically employ techniques such as:

  • Protein structure prediction algorithms

  • Hydrophobicity analysis to identify transmembrane regions

  • Sequence homology comparisons with characterized proteins

  • Expression analysis under different cellular conditions

How does DDB_G0285229 behave in terms of lateral diffusion in the cell membrane?

Like other transmembrane proteins in Dictyostelium discoideum, DDB_G0285229 likely exhibits free diffusion behavior characterized by three distinct diffusion states with similar diffusion coefficients regardless of structural variability . This multistate free diffusion can be visualized and analyzed using single-molecule imaging techniques.

Methodology for studying lateral diffusion:

  • Express DDB_G0285229 with a fluorescent tag (such as HaloTag) in D. discoideum cells

  • Stain with a fluorescent ligand like tetramethylrhodamine

  • Observe under total internal reflection fluorescence microscopy (TIRFM)

  • Acquire images at 30 frames/second

  • Calculate mean square displacement (MSD) to characterize diffusion modes

  • Apply hidden Markov modeling to analyze single-molecule trajectories

What are the essential materials and methods for expressing recombinant DDB_G0285229?

For expressing recombinant DDB_G0285229, the following materials and methods are recommended:

Materials:

  • Expression vector containing DDB_G0285229 gene with His-tag

  • E. coli expression system (commonly used for this protein)

  • Appropriate antibiotics for selection

  • IPTG for induction

  • Lysis buffer and purification reagents

Method:

  • Transform expression vector into E. coli

  • Culture in selective media until optimal density

  • Induce expression with IPTG

  • Harvest cells and lyse

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Verify purity using SDS-PAGE and Western blotting

  • Store in appropriate buffer with glycerol at -80°C

How does the membrane environment affect the diffusion properties of DDB_G0285229?

The diffusion properties of transmembrane proteins in D. discoideum, including DDB_G0285229, are primarily determined by the membrane environment rather than intrinsic protein characteristics. Based on the Saffman–Delbrück model, membrane viscosity, not protein size, is the major determinant of lateral mobility .

Methodological approach to investigate:

  • Manipulate membrane composition using lipid exchange techniques

  • Deplete specific lipids using biosynthetic inhibitors

  • Track DDB_G0285229 diffusion using single-particle tracking

  • Compare diffusion coefficients across different membrane conditions

  • Apply the following equation from the Saffman–Delbrück model:
    D = (kT/4πηh)[ln(ηh/ηʹr) - γ]
    Where:

    • D is the diffusion coefficient

    • k is Boltzmann's constant

    • T is temperature

    • η is membrane viscosity

    • h is membrane thickness

    • ηʹ is surrounding fluid viscosity

    • r is protein radius

    • γ is Euler's constant

How do cytoskeletal elements influence DDB_G0285229 mobility in the plasma membrane?

Transmembrane proteins in D. discoideum show reduced mobility upon inhibition of microtubule or actin cytoskeleton dynamics, or myosin II . To investigate this for DDB_G0285229 specifically:

Experimental approach:

  • Express fluorescently tagged DDB_G0285229 in D. discoideum cells

  • Establish baseline diffusion properties using single-molecule tracking

  • Treat cells with specific inhibitors:

    • Nocodazole or colchicine for microtubules

    • Latrunculin A or cytochalasin D for actin

    • Blebbistatin for myosin II

  • Measure changes in diffusion coefficient and state transitions

  • Quantify the extent of mobility reduction using the following data analysis method:

    • Calculate mean square displacement (MSD) before and after treatment

    • Apply hidden Markov modeling to identify state transitions

    • Compare transition probabilities between diffusion states

What are the potential functional interactions of DDB_G0285229 with other membrane proteins?

As an uncharacterized protein, the interactions of DDB_G0285229 with other proteins remain to be fully elucidated. To investigate these interactions:

Methodological approach:

  • Perform co-immunoprecipitation (Co-IP) assays using antibodies against DDB_G0285229

  • Conduct yeast two-hybrid screening

  • Use proximity labeling techniques (BioID or APEX)

  • Employ FRET or BRET to detect protein-protein interactions in live cells

  • Analyze changes in DDB_G0285229 diffusion properties in the presence/absence of potential interacting proteins

  • Create an interaction network based on identified partners

How should I design experiments to characterize the function of DDB_G0285229?

When designing experiments to characterize DDB_G0285229 function:

  • Begin with a clear hypothesis based on sequence homology or predicted structure

  • Plan multiple complementary approaches:

    • Loss-of-function studies (gene knockout, RNAi)

    • Gain-of-function studies (overexpression)

    • Localization studies (fluorescent tagging)

    • Phenotypic assays relevant to membrane protein function

  • Include appropriate controls:

    • Wild-type cells

    • Cells expressing a control transmembrane protein

    • Negative controls for protein-protein interaction studies

  • Ensure experimental conditions reflect the physiological environment:

    • Proper growth conditions for D. discoideum

    • Consideration of developmental stage

    • Appropriate membrane environment

  • Plan for at least three independent biological replicates

What controls are essential when studying DDB_G0285229 lateral diffusion?

When studying lateral diffusion of DDB_G0285229, the following controls are essential:

Experimental protocol:

  • Prepare cells expressing fluorescently tagged DDB_G0285229

  • Conduct single-molecule imaging under standard conditions

  • Repeat imaging under various perturbation conditions

  • Analyze trajectories using hidden Markov modeling

  • Compare diffusion coefficients and state transitions across conditions

How should I analyze and interpret diffusion data for DDB_G0285229?

Analyzing diffusion data for DDB_G0285229 requires several methodological steps:

  • Calculate mean square displacement (MSD):

    • Plot MSD vs. time interval

    • Linear relationship indicates free diffusion

    • Determine diffusion coefficient from the slope

  • Apply hidden Markov modeling:

    • Identify distinct diffusion states

    • Determine transition probabilities between states

    • Compare with known patterns for other transmembrane proteins

  • Statistical analysis:

    • Perform ANOVA to compare diffusion coefficients across conditions

    • Use post-hoc tests to identify significant differences

    • Calculate confidence intervals for diffusion coefficients

  • Visualization:

    • Generate trajectory plots

    • Create heat maps of residence probability

    • Develop state transition diagrams

  • Interpretation framework:

    • Compare to the membrane field model for D. discoideum

    • Assess consistency with the Saffman–Delbrück model

    • Evaluate the influence of membrane heterogeneity

How can I resolve contradictory results when studying DDB_G0285229 function?

When facing contradictory results in DDB_G0285229 research:

  • Systematically analyze experimental variables:

    • Different expression systems

    • Varied cellular contexts

    • Distinct analytical methods

    • Environmental conditions

  • Perform reconciliation experiments:

    • Design studies that directly address contradictions

    • Incorporate multiple methodologies within single experiments

    • Consider time-resolved approaches to capture dynamic changes

  • Statistical validation:

    • Increase sample size to improve statistical power

    • Apply more rigorous statistical tests

    • Consider Bayesian approaches for complex datasets

  • Collaborate with experts:

    • Engage researchers with complementary expertise

    • Use independent laboratories to verify key findings

    • Implement cross-validation protocols

  • Functional assessment data interpretation:

    • Analyze conditions where the protein behavior differs

    • Look for patterns that suggest contextual functionality

    • Consider if absence of behavior in certain conditions indicates adequately met cellular needs

What techniques can reveal the relationship between DDB_G0285229 structure and function?

To elucidate the relationship between DDB_G0285229 structure and function:

  • Structural analysis techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for specific domains

    • Computational modeling and simulation

  • Structure-function analysis methods:

    • Site-directed mutagenesis of key residues

    • Domain swapping with related proteins

    • Truncation analysis

    • Insertion of reporter groups at specific positions

  • Membrane integration studies:

    • Accessibility mapping using chemical modifications

    • Glycosylation mapping

    • Protease protection assays

    • Fluorescence quenching techniques

  • Functional assays based on predicted roles:

    • Transport assays if a transporter function is suspected

    • Signaling assays if involved in signal transduction

    • Protein-protein interaction studies if functioning as a scaffold

How can I develop a comprehensive experimental model to study DDB_G0285229 in the context of membrane organization?

To develop a comprehensive model for studying DDB_G0285229 in membrane organization:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.