Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0285385 (DDB_G0285385)

Shipped with Ice Packs
In Stock

Description

Protein Overview

DDB_G0285385 is encoded by the gene DDB_G0285385 in Dictyostelium discoideum. It is annotated as a putative transmembrane protein with a length of 303 amino acids (UniProt ID: Q54N94) . Recombinant versions are produced for research applications, enabling biochemical and structural studies.

Key Attributes:

PropertyDetails
OrganismDictyostelium discoideum (Slime mold)
Protein Length303 amino acids
Molecular Weight~34 kDa (predicted)
Expression HostEscherichia coli
TagN-terminal His-tag (for purification)
SequenceAvailable via UniProt (Q54N94) or supplier datasets

Recombinant Production

The recombinant protein is expressed in E. coli and purified using affinity chromatography. Key steps include:

  • Construct Design: Codon-optimized for prokaryotic expression.

  • Purification: His-tag affinity followed by size-exclusion chromatography .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0), stable at -20°C/-80°C .

Expression and Quality Control:

ParameterDetails
Purity>90% (SDS-PAGE verified)
ReconstitutionDeionized water or custom buffers (e.g., with glycerol for stability)
ApplicationsELISA, structural studies, interaction assays

Functional Insights

While the exact role of DDB_G0285385 is unknown, its classification as a transmembrane protein suggests potential involvement in:

  • Membrane trafficking: Analogous to other Dictyostelium transmembrane proteins regulating endocytosis or macropinocytosis .

  • Cell signaling: Possible interaction with conserved pathways like the γ-secretase complex, which modulates membrane dynamics in Dictyostelium .

Experimental Observations:

  • Retention in membrane fractions: Observed in detergent-insoluble cytoskeletal preparations .

  • Interaction assays: Direct binding partners remain unidentified, though yeast two-hybrid screens are pending .

Research Applications

Recombinant DDB_G0285385 is primarily used for:

  1. Antibody production: Immunogen for generating custom antibodies .

  2. Structural studies: Crystallization trials or cryo-EM to resolve 3D architecture.

  3. Pathway analysis: Screening for involvement in conserved signaling cascades (e.g., autophagy, phagocytosis) .

Outstanding Questions

  • Biological function: No in vivo studies have yet linked DDB_G0285385 to specific cellular processes.

  • Pathway associations: Potential roles in nutrient retention or membrane recycling (hypothesized from Dictyostelium polyphosphate studies) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery time estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
DDB_G0285385; Putative uncharacterized transmembrane protein DDB_G0285385
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0285385
Target Protein Sequence
MEFIINKINNIKNNNDNNNNINNNSNNNNNNNNNSNNNKFKFKYEFEFGYCYDVNLYEWR FIQDYETVPLKLNGILSNDEYNSILNIIGDVYDKTDKYPHVTYLLSIIMMVLLCMLPSVM AIHSNLNSYIQFVLFDDIFILITFILIPFLFFLKKKVIIENNYVIKGLKNRSIKLNIEYY KFKLLYFFFLLLWVPQGFLQSLIYKKRVLNEDFFNLKISLFILLGIDLIFILFAIWNFLL FTKLNRFLIKDRRDENILITLNSNIKKFLSPMEFYLTCNNTLNFFLNNNDNHFFPIDLDD PNV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.