Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288353 (DDB_G0288353)

Shipped with Ice Packs
In Stock

Description

Introduction to Dictyostelium discoideum and DDB_G0288353

Dictyostelium discoideum is a soil-dwelling amoeba belonging to the phylum Amoebozoa, commonly referred to as slime mold. This eukaryotic organism serves as a valuable model system due to its unique life cycle, transitioning from unicellular amoebae to multicellular structures, culminating in the formation of a fruiting body . The organism's genome contains numerous orthologs of genes implicated in human diseases, making it an important model for studying fundamental cellular processes .

The protein DDB_G0288353 is classified as a putative uncharacterized transmembrane protein within the D. discoideum proteome. Transmembrane proteins typically span the entirety of the cell membrane, often functioning as gateways for transporting specific substances across membranes . Despite being categorized as "uncharacterized," computational analysis and structural predictions provide considerable information about this protein's potential characteristics and functions.

Transmembrane Topology

Based on sequence analysis, DDB_G0288353 likely contains a single transmembrane domain in its N-terminal region. The hydrophobic sequence "FIGIVLFLAVLIIGILILILFYYN" at positions 25-49 matches the characteristic pattern of alpha-helical transmembrane segments . This suggests DDB_G0288353 is a single-pass transmembrane protein, with its N-terminus potentially oriented toward the extracellular space and its C-terminus facing the cytoplasm.

Molecular Properties

The recombinant form of DDB_G0288353 is commercially available as a research reagent with the following specifications:

PropertySpecification
Protein LengthFull length (1-168 amino acids)
Molecular WeightApproximately 18-20 kDa (estimated)
Expression SystemE. coli
Tag InformationVariable (depends on preparation)
FormLyophilized powder
PurityTypically >90% as determined by SDS-PAGE
UniProt IDQ54J19
Gene NameDDB_G0288353

Table 1: Molecular properties and specifications of recombinant DDB_G0288353

Expression and Purification of Recombinant DDB_G0288353

Recombinant DDB_G0288353 is typically expressed in E. coli expression systems. The process involves transformation of E. coli with a plasmid containing the DDB_G0288353 coding sequence (corresponding to amino acids 1-168), often with an N-terminal tag to facilitate purification .

The purification protocol generally follows standard procedures for hydrophobic transmembrane proteins, which may include:

  1. Cell lysis under denaturing or detergent-containing conditions

  2. Affinity chromatography using the attached tag

  3. Size exclusion chromatography for further purification

  4. Quality assessment via SDS-PAGE to ensure >90% purity

The resulting protein is typically formulated in a stabilizing buffer containing Tris and glycerol, then lyophilized for long-term storage and distribution .

Membrane Trafficking and Transport

As a transmembrane protein, DDB_G0288353 may participate in cellular transport processes. D. discoideum relies on sophisticated membrane trafficking systems during both its unicellular and multicellular phases . Given the protein's structure, it could potentially function in:

  1. Nutrient transport during the vegetative phase

  2. Cell-cell communication during aggregation and development

  3. Membrane remodeling during the transition to multicellularity

Model Organism Studies Using Recombinant DDB_G0288353

Recombinant DDB_G0288353 can serve as a valuable tool in several research contexts:

  1. Protein-Protein Interaction Studies: The protein can be used in pull-down assays to identify binding partners, potentially revealing functional networks .

  2. Antibody Production: As an antigen for generating specific antibodies, which can subsequently be used for localization studies in D. discoideum cells .

  3. Structural Biology: Despite the low confidence of current computational models, the recombinant protein could be used for experimental structure determination via X-ray crystallography or cryo-electron microscopy .

Relevance to Broader Cellular Biology Research

D. discoideum serves as an excellent model for studying various cellular processes including chemotaxis, phagocytosis, and cell motility . Transmembrane proteins like DDB_G0288353 may play critical roles in these processes:

  1. Sentinel Cell Function: D. discoideum possesses sentinel cells that help protect multicellular structures from pathogens. Transmembrane proteins are likely involved in pathogen recognition and response mechanisms .

  2. Bacterial Resistance: D. discoideum is used to identify factors that contribute to bacterial resistance, and membrane proteins often mediate host-pathogen interactions .

  3. Neurodegenerative Disease Research: D. discoideum is increasingly used as a model for investigating neurodegenerative diseases, with membrane proteins potentially playing roles analogous to those in human neural cells .

Characterization Strategies

To fully characterize DDB_G0288353, several approaches could prove valuable:

  1. Gene Knockout Studies: CRISPR-Cas9-mediated knockout of DDB_G0288353 in D. discoideum could reveal phenotypic changes indicating the protein's function.

  2. Localization Studies: Fluorescent tagging of DDB_G0288353 would help determine its subcellular distribution and dynamics during different life cycle stages.

  3. Interactome Analysis: Identifying the protein's interaction partners could place it within specific cellular pathways.

Comparative Analysis Opportunities

Comparing DDB_G0288353 with other transmembrane proteins could yield valuable insights:

  1. Cross-Species Comparison: Identifying potential homologs in other organisms might reveal evolutionary conservation patterns.

  2. Functional Analogs: While sequence homology might be limited, functional similarities with characterized proteins could provide clues to DDB_G0288353's role.

  3. Expression Pattern Analysis: Determining when and where the protein is expressed during D. discoideum's life cycle could correlate with specific developmental processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0288353; Putative uncharacterized transmembrane protein DDB_G0288353
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0288353
Target Protein Sequence
MVIPNLHNSIPICGKCDPKLTNSFIGIVLFLAVLIIGILILILFYYNKEINKNSSQYLPI HSPGSGNPSPSSSFLINNNNNNNNYHQNNNSNNNNIIYNPYYNSSTTSPYYLSPNSNHNP SLILYHQSRLLGNIHSINSINNNNNNNNNNPPTNISNKLNKNGETKNI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it a valuable model for studying transmembrane proteins?

Dictyostelium discoideum is a social amoeba that serves as an established model organism for investigating membrane protein dynamics and function. This lower eukaryote offers several advantages:

  • It provides a simplified cellular system while maintaining core eukaryotic processes

  • Its membrane structure exhibits relatively simple diffusion properties compared to higher eukaryotes

  • It has been established for single-molecule imaging of membrane proteins

  • All transmembrane proteins exhibit free diffusion with similar diffusion coefficients despite structural variability

  • The relationship between protein size and diffusion coefficient follows the Saffman–Delbrück model, indicating that membrane viscosity rather than protein size determines lateral mobility

These characteristics make D. discoideum particularly valuable for initial characterization of novel transmembrane proteins like DDB_G0288353 before proceeding to more complex systems.

What expression systems are most effective for recombinant transmembrane proteins in D. discoideum?

For successful expression of recombinant transmembrane proteins in D. discoideum, researchers should consider the following methodological approach:

  • Expression vector selection: Vectors containing D. discoideum-specific promoters provide optimal expression

  • Tag selection: HaloTag at the C-terminus has been successfully used for single-molecule imaging of transmembrane proteins

  • Cell line: AX2 wild-type cells are commonly used for stable transformants

  • Expression verification: Total internal reflection fluorescence microscopy (TIRFM) after tag staining with fluorescent ligands (e.g., tetramethylrhodamine)

When selecting candidate proteins for expression, it's important to note that success rates may be variable. In one comprehensive study, only 27 out of 143 selected transmembrane proteins exhibited stable expression on the plasma membrane when introduced into wild-type AX2 cells .

How can transmembrane protein function be preliminarily assessed through bioinformatic analysis?

Initial characterization of DDB_G0288353 should begin with comprehensive bioinformatic analysis:

  • Domain identification: Search for conserved domains such as DUF3430, which is present in several D. discoideum bacteriolytic proteins (BadA, BadB, and BadC)

  • Transmembrane topology prediction: Estimate the number and position of transmembrane regions using algorithms like TMHMM

  • Phylogenetic analysis: Determine evolutionary relationships to characterized proteins

  • Functional prediction: D. discoideum proteins sometimes exhibit closer relationships to bacterial proteins than to other eukaryotic homologs , which may provide functional insights

For putative transmembrane proteins like DDB_G0288353, identification of potential domains associated with bacteriolytic activity would be particularly relevant given D. discoideum's role as a professional phagocyte.

What experimental approaches can characterize the diffusion dynamics of DDB_G0288353?

To investigate diffusion dynamics of the transmembrane protein DDB_G0288353, implement the following experimental workflow:

  • Single-molecule imaging preparation:

    • Express DDB_G0288353 with HaloTag at the C-terminus

    • Stain with fluorescent Halo-ligand conjugated to tetramethylrhodamine

    • Image basal membrane of non-polarized vegetative cells using TIRFM at 30 frames/s

  • Trajectory analysis:

    • Calculate mean square displacement (MSD) to determine diffusion mode

    • Apply hidden Markov model (HMM) for detecting multiple diffusion states

    • Assess state transition probabilities

  • Comparative analysis:

    • Compare diffusion coefficients with other transmembrane proteins

    • Analyze effects of cytoskeletal inhibitors on mobility

Based on studies of other D. discoideum transmembrane proteins, you can expect to identify three distinct diffusion states with similar diffusion coefficients regardless of protein structure, with coefficients ranging from 0.019 to 0.033 μm²/s .

How can researchers investigate potential bacteriolytic activity of DDB_G0288353?

For investigating potential bacteriolytic activity of DDB_G0288353, implement this systematic approach:

  • In vitro activity assay:

    • Prepare cell extracts from wild-type and DDB_G0288353-overexpressing cells

    • Test bacteriolytic activity at acidic pH (~pH 2) to mimic phagosomal conditions

    • Monitor lysis of Klebsiella pneumoniae by spectrophotometry at 450 nm

    • Compare activity against wild-type and waaQ mutant K. pneumoniae (the latter being more susceptible to D. discoideum bacteriolytic proteins)

  • Protein purification and activity confirmation:

    • Fractionate cell extracts to enrich for DDB_G0288353

    • Correlate bacteriolytic activity with protein concentration

    • Perform depletion experiments to confirm specificity

  • In vivo bacterial killing assays:

    • Generate cells overexpressing DDB_G0288353

    • Compare bacterial killing efficiency between wild-type and overexpressing cells

    • Use time-course experiments to measure killing kinetics

  • Control experiments:

    • Compare with kil1 and kil2 knockout cells, which have distinct defects in bacterial killing

Cell TypeExpected Bacteriolytic ActivityRationale
Wild-type++Normal bacteriolytic function
kil1 KO+Reduced bacteriolytic activity in vitro and in vivo
kil2 KO++Normal activity in vitro despite killing defect in vivo
DDB_G0288353 overexpression+++ (if involved in bacteriolysis)Enhanced activity if protein participates in bacterial killing

This framework is based on successful characterization of the BadA bacteriolytic protein in D. discoideum .

How does the A+T-rich genome of D. discoideum impact expression and functional characterization of DDB_G0288353?

The extremely A+T-rich genome of D. discoideum presents specific challenges for working with transmembrane proteins like DDB_G0288353:

  • Codon optimization challenges: The biased nucleotide composition affects codon usage, requiring specialized optimization strategies

  • Gene manipulation considerations: PCR amplification and cloning of A+T-rich sequences require specialized approaches

  • Functional implications: D. discoideum proteins often display narrow substrate specificity that reflects the biased genome composition

For functional characterization, consider that the A+T-rich genomic context may have led to unique adaptations in DDB_G0288353 that might not be predictable based on homology to proteins from organisms with different nucleotide compositions.

What approaches can resolve contradictory data when characterizing DDB_G0288353?

When facing contradictory results during characterization of DDB_G0288353, implement this systematic troubleshooting approach:

  • Expression level assessment:

    • Verify that expression levels are not causing artifacts

    • Compare results between native expression and various overexpression levels

  • Tag interference evaluation:

    • Test multiple tag positions (N-terminal, C-terminal, internal)

    • Compare different tag types to rule out tag-specific effects

  • Cellular context variation:

    • Examine protein function during different developmental stages

    • Test function in multiple genetic backgrounds

  • Methodological cross-validation:

    • Apply complementary techniques to verify key findings

    • For diffusion studies, compare results from single-particle tracking with fluorescence recovery after photobleaching (FRAP)

    • For bacteriolytic activity, compare in vitro and in vivo assays

This approach addresses the common sources of contradictory data when working with putative uncharacterized proteins.

What single-molecule imaging approaches provide the most detailed insights into DDB_G0288353 membrane dynamics?

For comprehensive characterization of DDB_G0288353 membrane dynamics, employ these advanced single-molecule techniques:

  • Multi-color single-particle tracking:

    • Simultaneously track DDB_G0288353 and known membrane markers

    • Analyze co-diffusion and potential interactions

  • High-speed imaging:

    • Capture frames at 30 frames/s or faster to resolve rapid diffusion events

    • Apply specialized algorithms for connecting trajectories

  • State identification analysis:

    • Implement hidden Markov modeling to identify distinct diffusion states

    • Calculate state occupancy probabilities and transition frequencies

    • Determine if DDB_G0288353 exhibits the three diffusion states typical of D. discoideum transmembrane proteins

  • Membrane perturbation studies:

    • Assess effects of cytoskeletal inhibitors on mobility

    • Test membrane fluidity modifiers to evaluate viscosity dependence

This approach leverages the finding that D. discoideum has "a relatively simple membrane structure capable of producing multi-state free diffusion" , making it ideal for fundamental studies of membrane protein dynamics.

How can researchers distinguish between direct and indirect effects in DDB_G0288353 knockout studies?

To differentiate between direct and indirect effects in DDB_G0288353 knockout studies:

  • Complementation analysis:

    • Reintroduce wild-type DDB_G0288353 to knockout cells

    • Create point mutations in key domains to identify essential residues

    • Develop chimeric constructs to identify functional domains

  • Acute protein inactivation:

    • Implement auxin-inducible degron system for rapid protein depletion

    • Compare acute vs. chronic depletion phenotypes to distinguish primary from secondary effects

  • Temporal analysis of phenotypes:

    • Document the sequence of phenotypic changes following knockout

    • Early phenotypes are more likely to represent direct effects

  • Biochemical validation:

    • For putative bacteriolytic activity, perform in vitro assays with purified protein

    • Test whether purified DDB_G0288353 can directly lyse bacteria at acidic pH

  • Comparative studies with known proteins:

    • Compare phenotypes with knockouts of characterized proteins (e.g., BadA, BadB, BadC)

    • Analyze potential redundancy through double knockout studies

This methodological framework enables robust determination of DDB_G0288353's direct functional roles versus secondary effects caused by its absence.

How might the multi-state diffusion model of D. discoideum transmembrane proteins inform studies of DDB_G0288353?

The discovery that D. discoideum transmembrane proteins exhibit three-state free diffusion regardless of protein structure provides a framework for investigating DDB_G0288353:

  • Functional microdomain association:

    • Determine if DDB_G0288353 shows preferential association with specific diffusion states

    • Compare state occupancy with proteins of known function

  • Structure-function relationships:

    • Analyze how modifications to DDB_G0288353 affect its diffusion state distribution

    • Compare with the diffusion behavior of other transmembrane proteins with 1-10 transmembrane domains

  • Physiological relevance:

    • Investigate whether DDB_G0288353 diffusion states change during phagocytosis

    • Test if bacterial challenge alters protein mobility

  • Lipid raft association:

    • Since the "slow" diffusion region in D. discoideum is comparable in size to lipid rafts in mammalian cells , determine if DDB_G0288353 associates with these microdomains

This approach leverages D. discoideum's "relatively simple membrane structure capable of producing multi-state free diffusion" to gain insights into DDB_G0288353's functional dynamics.

What are the most promising approaches for determining if DDB_G0288353 belongs to the bacteriolytic protein family?

To investigate whether DDB_G0288353 belongs to the bacteriolytic protein family like BadA, BadB, and BadC:

  • Domain structure analysis:

    • Search for DUF3430 domain presence, which characterizes the Bad protein family

    • Analyze signal sequences for potential localization to phagosomes

  • pH-dependent activity profiling:

    • Test bacteriolytic activity at pH range 2-7

    • True bacteriolytic proteins like BadA show activity only at very acidic pH (~2) mimicking phagosomal conditions

  • Substrate specificity assessment:

    • Test activity against different bacterial species

    • Compare activity against wild-type and cell wall-deficient bacteria (e.g., K. pneumoniae waaQ mutant)

  • Genetic interaction studies:

    • Create double knockouts with kil1, which exhibits reduced bacteriolytic activity

    • Test for synthetic phenotypes suggesting shared pathways

  • Localization and recruitment dynamics:

    • Track protein localization during phagocytosis

    • Assess recruitment timing to phagosomes

TestPositive Result Indicating Bacteriolytic Function
Activity at pH 2Significant bacteriolytic activity
Activity against K. pneumoniae waaQEnhanced activity compared to wild-type K. pneumoniae
Activity in kil1 KO backgroundReduced activity compared to wild-type cells
Phagosomal recruitmentLocalization to maturing phagosomes

This systematic approach will determine whether DDB_G0288353 shares functional characteristics with the characterized bacteriolytic proteins in D. discoideum .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.