Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288661 (DDB_G0288661)

Shipped with Ice Packs
In Stock

Description

Dictyostelium discoideum as a Model Organism

Dictyostelium discoideum is a cellular slime mold valuable in studying cell and developmental biology because of its simple life cycle and ease of use . It serves as a source of novel lead compounds for pharmacological and medical research .

Protein Function and Structure

The function of a protein is largely dictated by its structure, which in turn, is determined by its amino acid sequence . The primary structure is the amino acid sequence, while the secondary structure involves localized shapes such as alpha helices and beta-pleated sheets, stabilized by hydrogen bonds2. The tertiary structure is the complete three-dimensional folding pattern of the protein2.

Transmembrane Proteins

Transmembrane proteins are proteins that span a cell membrane. They have different functions, including transport of molecules across membranes, signal transduction, and cell adhesion. Given that DDB_G0288661 is annotated as a transmembrane protein, it is likely involved in one or more of these functions.

Protein Function Annotation Tools

Tools such as PhaGO can be used to annotate protein functions in bacteriophages by leveraging the modular genomic structure of phage genomes . PhaGO uses embeddings from protein foundation models and Transformers to capture contextual information between proteins in phage genomes . ProteinChat is another tool that uses a multi-modal large language model to predict protein functions and generate comprehensive narratives describing these functions based on the protein’s amino acid sequence .

Developmental Regulation of Plasma Membrane Proteins in Dictyostelium discoideum

Research indicates significant developmental changes in the plasma membrane proteins of Dictyostelium discoideum . A study using metabolic labeling and two-dimensional electrophoresis showed that the profile of newly synthesized plasma membrane proteins changes dramatically during development .

Pulse labeling for 1 h at the early interphase, late interphase, aggregation, and tip formation stages of development showed that the profile of newly synthesized plasma membrane proteins changed dramatically over this interval .

Specifically, only 14% of polypeptide species were synthesized at all four stages, while 86% changed over the developmental interval . This suggests that many proteins are expressed in a stage-specific manner and participate in developmentally important functions .

Potential Functions of DDB_G0288661

  • Cell signaling: As a transmembrane protein, DDB_G0288661 could be involved in signal transduction pathways.

  • Transport: It may facilitate the transport of molecules across the cell membrane.

  • Cell adhesion: It could play a role in cell-cell or cell-matrix interactions.

  • Developmental processes: Given the developmental changes observed in Dictyostelium plasma membrane proteins, it could be involved in specific developmental stages .

Methodologies for Studying Protein Function

Several methodologies can be employed to study the function of DDB_G0288661:

  • Gene knockout/knockdown: Disrupting the gene encoding DDB_G0288661 and observing the resulting phenotype can provide insights into its function .

  • Protein localization studies: Using fluorescent tags to determine the protein's location within the cell can suggest its role.

  • Interaction studies: Identifying proteins that interact with DDB_G0288661 can provide clues about its function and the pathways it is involved in.

  • Functional assays: Developing in vitro assays to test the protein's activity can help elucidate its biochemical function.

  • Structural studies: Determining the three-dimensional structure of the protein can provide insights into its function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
DDB_G0288661; Putative uncharacterized transmembrane protein DDB_G0288661
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-307
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0288661
Target Protein Sequence
QVENSKKEKVDVSALIQSYGSELFNYLNNWNKVEENNNKNNNNNNNNNNNNNNNNKNSKV KNDDSIVNTFSNYGNQILNYLNIGDGGEKQKQNQKEKENQSVFSKFSNNVLGLFNFEKTK DKKEDEGILPSIIKNIQDYVKWGKNENNESSGDKYPNFETQSSSFSHSPYGDIFGININD IIASPLLNEISDSSLNYLKQQFGLSNQIIQLLIQFRNTIIFAITFIIFLFTYLIIYYLAS IGNSIVISFIIGVLTVFLWVIITLLFTIVIGYKKNGEKTLEL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and predicted function of DDB_G0288661 transmembrane protein?

DDB_G0288661 is a putative transmembrane protein in Dictyostelium discoideum with currently limited functional characterization. Based on sequence analysis and structural prediction algorithms, this protein likely contains multiple transmembrane domains characteristic of membrane transport or signaling proteins. Computational analysis suggests potential roles in cellular processes such as chemotaxis, membrane trafficking, or nutrient sensing, which are critical functions in Dictyostelium biology .

For initial characterization, researchers should employ a combination of bioinformatic approaches:

Analysis MethodExpected OutcomeBioinformatic Tools
Sequence homology analysisIdentification of conserved domains and potential orthologuesBLAST, HMMER, Pfam
Transmembrane domain predictionNumber and position of membrane-spanning regionsTMHMM, Phobius, HMMTOP
Subcellular localization predictionProbable cellular compartmentTargetP, PSORT, DeepLoc
Secondary structure predictionStructural elements (α-helices, β-sheets)PSIPRED, JPred
Phylogenetic analysisEvolutionary relationships with characterized proteinsMEGA, PhyML, MrBayes

How does DDB_G0288661 expression change during Dictyostelium development?

The expression profile of DDB_G0288661 likely varies throughout the Dictyostelium life cycle, which consists of distinct unicellular and multicellular phases spanning approximately 24 hours . Recent studies of transmembrane proteins in Dictyostelium suggest that many uncharacterized membrane proteins show stage-specific expression patterns corresponding to key developmental transitions .

To characterize the temporal expression pattern:

  • Perform quantitative RT-PCR analysis at 4-hour intervals throughout the 24-hour developmental cycle

  • Generate a GFP-fusion reporter construct to visualize expression in live cells during development

  • Use RNA-seq data to compare expression levels across all developmental stages

  • Analyze protein levels via Western blotting with stage-specific samples

Expression data should be presented as relative fold changes compared to vegetative growth phase levels and correlated with morphological stages (aggregation, mound formation, slug stage, and fruiting body formation) .

What experimental systems are available for studying DDB_G0288661 in Dictyostelium?

Dictyostelium discoideum offers multiple experimental advantages for studying uncharacterized proteins like DDB_G0288661, including:

  • Haploid genome that facilitates gene disruption and phenotypic analysis

  • Rapid growth and 24-hour developmental cycle allowing quick phenotypic assessment

  • Well-established genetic manipulation tools including CRISPR-Cas9 gene editing

  • Available mutant libraries for genetic screens

Experimental SystemApplicationsAdvantagesLimitations
REMI mutagenesisRandom insertional mutagenesis to identify gene functionHigh-throughput screening capability, random insertionMay cause off-target effects, requires phenotypic screening
CRISPR-Cas9Targeted gene disruption or modificationPrecise editing, ability to generate knock-insRequires optimization for Dictyostelium, potential off-target effects
Expression vectorsProtein localization, rescue experimentsMultiple tags available (GFP, RFP, etc.), inducible systemsOver-expression artifacts, fusion proteins may alter function
Homologous recombinationGene knockout or replacementEstablished methodology in DictyosteliumLabor-intensive, lower efficiency than CRISPR

How should I design experiments to determine the cellular localization of DDB_G0288661?

To determine the subcellular localization of DDB_G0288661, a multi-faceted experimental approach is recommended:

  • Fluorescent protein fusions:

    • Generate both N- and C-terminal GFP fusion constructs, as tag position may affect localization

    • Express under native and constitutive promoters to assess expression-level effects

    • Perform time-lapse imaging throughout the developmental cycle

  • Co-localization studies:

    • Use established organelle markers (endoplasmic reticulum, Golgi, endosomes, plasma membrane)

    • Perform immunofluorescence with compartment-specific antibodies

    • Analyze Pearson's correlation coefficients for quantitative co-localization assessment

  • Biochemical fractionation:

    • Separate cellular components (cytosol, membrane, nuclear fractions)

    • Perform Western blot analysis to detect protein in specific fractions

    • Consider detergent solubility to assess membrane microdomain association

  • Immuno-electron microscopy:

    • For high-resolution localization if initial studies indicate interesting patterns

    • Particularly valuable for multi-membrane structures or small vesicles

When analyzing localization data, remember that transmembrane proteins often transit through various compartments, and localization may change during development or in response to environmental cues .

What approaches can I use to investigate protein-protein interactions of DDB_G0288661?

Understanding the interaction partners of DDB_G0288661 will provide crucial insights into its function. Several complementary approaches are recommended:

ApproachDescriptionAdvantagesLimitations
Co-immunoprecipitation (Co-IP)Pull-down of protein complexes using antibodies or epitope tagsIdentifies native interactions, can detect transient interactionsRequires high-quality antibodies or tagged constructs, potential for non-specific binding
Proximity labeling (BioID/TurboID)Enzymatic labeling of proximal proteinsMaps spatial proteome surrounding the protein, detects transient interactionsMay label proteins in proximity but not direct interactors
Yeast two-hybrid (Y2H) screeningBinary interaction detection in yeastHigh-throughput capability, detects direct interactionsHigh false positive/negative rates, membrane proteins often problematic
Mass spectrometryIdentification of co-purified proteinsUnbiased, high sensitivityComplex data analysis, distinguishing specific from non-specific interactions
FRET/BRETEnergy transfer between fluorescent proteinsDetects interactions in live cells, spatial resolutionRequires protein tagging, potential artifacts from overexpression

To enhance specificity when studying membrane proteins:

  • Use crosslinking approaches to stabilize transient interactions

  • Consider membrane-specific interaction techniques like membrane-MYTH (membrane yeast two-hybrid)

  • Implement quantitative proteomics with SILAC labeling to distinguish true interactors from background

  • Validate key interactions through reciprocal Co-IP and functional studies

How can I generate and validate a DDB_G0288661 knockout strain?

Creating a gene knockout is essential for functional characterization. For DDB_G0288661, consider these approaches:

  • CRISPR-Cas9 gene disruption:

    • Design sgRNAs targeting early exons of DDB_G0288661

    • Include a blasticidin resistance cassette for selection

    • Screen transformants using PCR verification of target site

  • Homologous recombination:

    • Create a knockout construct with homology arms flanking a selectable marker

    • Transform Dictyostelium cells and select with appropriate antibiotic

    • Verify gene disruption through PCR, Southern blotting, and RT-PCR

  • Validation of knockout:

    • Confirm absence of transcript by RT-PCR and protein by Western blot

    • Assess growth rate and developmental timing compared to wild-type

    • Examine colony morphology on bacterial lawns (as described in result )

    • Perform detailed phenotypic analysis based on predicted function

  • Genetic rescue experiments:

    • Reintroduce wild-type DDB_G0288661 to confirm phenotype causality

    • Consider introducing orthologous genes to test functional conservation

    • Use inducible expression systems for temporal control

The primary screen for knockout phenotypes should examine colony morphology on bacterial lawns, as transmembrane proteins often affect processes like phagocytosis, chemotaxis, or cell-cell signaling that manifest in colony formation patterns .

What techniques should I use to assess if DDB_G0288661 is involved in chemotaxis or chemorepulsion?

Given that many transmembrane proteins in Dictyostelium are involved in sensing environmental cues, and based on the chemorepulsion studies described in result , the following methodologies are recommended:

  • Under-agarose chemotaxis assay:

    • Compare wild-type and DDB_G0288661-knockout cells' migration toward cAMP or folate

    • Quantify directionality, speed, and persistence of movement

    • Assess chemotactic index (CI) using the formula: CI = cos(θ), where θ is the angle between direction of movement and gradient

  • Micropipette assay:

    • Establish point source gradient using micropipette filled with chemoattractant

    • Record cell movement using time-lapse microscopy

    • Analyze cytoskeletal reorganization during directional movement

  • AprA-induced chemorepulsion assay:

    • Implement the methodology described in result to test if DDB_G0288661 functions in the AprA chemorepulsion pathway

    • Compare colony expansion patterns between wild-type and knockout strains

    • Quantify directionality bias in response to AprA gradients

  • Insall chamber assays:

    • Generate stable linear gradients for precise measurement of chemotactic responses

    • Analyze cell movement parameters including directional persistence and turning frequency

For data analysis, the following table format can be used to compare chemotactic parameters:

ParameterWild-typeDDB_G0288661-KOp-value
Speed (μm/min)X ± SDX ± SDCalculate significance
Chemotactic indexX ± SDX ± SDCalculate significance
DirectionalityX ± SDX ± SDCalculate significance
Response time (sec)X ± SDX ± SDCalculate significance

Analyze data using appropriate statistical methods such as Student's t-test for parametric data or Mann-Whitney U test for non-parametric data .

How do I investigate if DDB_G0288661 plays a role in phagocytosis or macropinocytosis?

Transmembrane proteins often function in membrane dynamics and cellular uptake processes. To assess the role of DDB_G0288661 in these processes:

  • Phagocytosis assays:

    • Quantify uptake of fluorescent beads or labeled bacteria over time

    • Determine phagocytic rate and capacity using flow cytometry

    • Visualize phagocytic cup formation using confocal microscopy

    • Measure bacterial killing efficiency if relevant

  • Macropinocytosis measurement:

    • Quantify uptake of fluid-phase markers (FITC-dextran)

    • Calculate macropinocytic index and compare between wild-type and knockout

    • Assess dependency on environmental conditions (nutrient availability)

  • Membrane dynamics analysis:

    • Track endocytic vesicle formation and trafficking using live-cell imaging

    • Analyze membrane recycling rates using FM4-64 dye

    • Examine phosphoinositide dynamics during uptake processes

  • Growth assessment:

    • Compare growth rates in axenic media versus bacterial suspensions

    • Quantify doubling times under different nutrient conditions

    • Assess ability to clear bacterial lawns

Data should be presented with appropriate statistical analysis and time-course measurements to detect subtle phenotypes that might be masked by compensatory mechanisms .

What experimental designs can help determine if DDB_G0288661 functions in cell-cell communication during development?

The multicellular development of Dictyostelium provides an excellent system to study cell-cell communication. To investigate DDB_G0288661's role in this process:

  • Developmental time-course analysis:

    • Document developmental progression at 4-hour intervals with photography

    • Quantify timing of key developmental transitions

    • Assess morphological abnormalities at each stage

  • Mixing experiments:

    • Create chimeric aggregates with wild-type and knockout cells at various ratios

    • Label cell populations with different fluorescent markers

    • Analyze spatial distribution of cell types in multicellular structures

    • Determine cell fate choices in mixed populations

  • Cell-cell adhesion assays:

    • Measure cohesion of cells in shaking cultures over developmental time

    • Quantify expression of developmental adhesion molecules (csA, gp80)

    • Assess cell sorting behavior in reconstitution experiments

  • Signaling pathway analysis:

    • Examine cAMP signaling efficiency using FRET sensors

    • Monitor expression of key developmental genes via qRT-PCR

    • Assess phosphorylation states of developmental signaling components

Results should be presented in a developmental timeline format comparing wild-type and knockout strains, with quantitative measurements of developmental markers at each stage .

How can I purify recombinant DDB_G0288661 for structural and functional studies?

Purification of transmembrane proteins presents unique challenges. For DDB_G0288661:

  • Expression system selection:

    • Consider heterologous systems (E. coli, insect cells, yeast)

    • Evaluate truncated constructs that exclude transmembrane domains

    • Test fusion tags that enhance solubility (MBP, SUMO)

  • Membrane protein extraction:

    • Screen detergents for efficient solubilization (Table below)

    • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environment

    • Implement two-phase extraction systems for initial enrichment

  • Purification strategy:

    • Employ affinity chromatography using epitope tags

    • Implement size exclusion chromatography for oligomeric state assessment

    • Consider ion exchange chromatography for final polishing

DetergentCritical Micelle ConcentrationRecommended ConcentrationApplication
DDM0.17 mM1-2% for extraction, 0.05% for purificationMild, maintains function
LMNG0.01 mM0.5-1% for extraction, 0.01% for purificationEnhanced stability
Digitonin~0.5 mM0.5-1%Preserves complexes
SDS8 mM0.5-2%Harsh, denatures
Triton X-1000.2-0.9 mM1% for extraction, 0.1% for purificationGeneral purpose
  • Quality control:

    • Verify protein purity by SDS-PAGE and Western blotting

    • Confirm structural integrity using circular dichroism

    • Assess homogeneity by dynamic light scattering

    • Validate functionality through specific activity assays if known

Experimental design should include appropriate controls and optimization of buffer conditions (pH, salt concentration, stabilizing additives) to maintain protein stability throughout the purification process .

What techniques can I use to determine if DDB_G0288661 undergoes post-translational modifications?

Post-translational modifications (PTMs) often regulate membrane protein function and trafficking. To identify PTMs on DDB_G0288661:

  • Mass spectrometry approaches:

    • Perform bottom-up proteomics with enrichment strategies for specific modifications

    • Use top-down proteomics for intact protein analysis

    • Implement targeted approaches for suspected modifications

  • Gel mobility shift assays:

    • Compare migration patterns before and after enzymatic treatments

    • Use Phos-tag gels for phosphorylation detection

    • Apply periodic acid-Schiff staining for glycosylation

  • Modification-specific detection:

    • Use phospho-specific antibodies if phosphorylation is suspected

    • Apply lectin blotting for glycosylation analysis

    • Implement ubiquitination-specific immunoprecipitation

  • Site-directed mutagenesis:

    • Mutate putative modification sites and assess functional consequences

    • Create phosphomimetic mutations (S/T to D/E) or non-phosphorylatable mutations (S/T to A)

    • Generate consensus sequence mutations for N-linked glycosylation sites

Results should be presented in a comprehensive table listing identified modifications, their sites, and potential functional significance based on conservation and structural predictions .

How can I design experiments to determine the membrane topology of DDB_G0288661?

Determining the membrane topology of transmembrane proteins is crucial for understanding their function. For DDB_G0288661, employ these complementary approaches:

  • Substituted cysteine accessibility method (SCAM):

    • Introduce cysteine residues at predicted loops/turns

    • Treat intact cells or permeabilized cells with membrane-impermeable thiol-reactive reagents

    • Identify exposed regions through differential labeling

  • Protease protection assays:

    • Treat isolated membranes with proteases in the presence or absence of detergents

    • Analyze protected fragments by mass spectrometry or immunoblotting

    • Map digestion sites to infer topology

  • Fluorescence-based approaches:

    • Create GFP fusion proteins at predicted loops

    • Use pH-sensitive GFP variants to distinguish cytosolic from lumenal orientations

    • Apply split-GFP complementation to verify compartment-specific exposures

  • Glycosylation mapping:

    • Introduce N-glycosylation sites at strategic positions

    • Assess glycosylation status to determine lumenal exposure

    • Use enzymatic deglycosylation to confirm modifications

Results should be presented as a topological map with experimental evidence supporting each transmembrane segment and loop orientation, compared against computational predictions from tools like TMHMM and TOPCONS .

How should I analyze and interpret contradictory phenotypes in DDB_G0288661 mutants?

Contradictory phenotypes are common in genetic studies and require careful analysis:

  • Systematic troubleshooting:

    • Verify the genetic modification using multiple methods (PCR, sequencing, expression analysis)

    • Create independent knockout lines to rule out off-target effects

    • Implement rescue experiments with wild-type gene to confirm specificity

    • Consider conditional knockouts if complete loss might trigger compensatory mechanisms

  • Environmental variable analysis:

    • Test phenotypes under different growth conditions (temperature, media composition)

    • Assess developmental timing effects through synchronized development

    • Consider cell density effects, particularly for secreted factors involved in quorum sensing

  • Genetic background considerations:

    • Use isogenic control strains for all comparisons

    • Consider potential suppressors or enhancers in laboratory strains

    • Implement CRISPR-based approaches in multiple genetic backgrounds

  • Data integration approaches:

    • Apply statistical methods appropriate for complex phenotypes (multivariate analysis)

    • Use principal component analysis to identify patterns across multiple parameters

    • Consider Bayesian approaches for integrating diverse data types

When presenting contradictory results, organize data in a comprehensive table showing conditions under which different phenotypes manifest, and discuss potential explanations based on known compensatory mechanisms or condition-specific requirements .

What statistical approaches are most appropriate for analyzing phenotypic data from DDB_G0288661 studies?

Proper statistical analysis is crucial for rigorous interpretation of research findings:

  • Experimental design considerations:

    • Determine appropriate sample sizes using power analysis

    • Implement randomization and blinding where possible

    • Include biological and technical replicates appropriately

    • Design factorial experiments to detect interaction effects

  • Statistical test selection:

    • For normally distributed data: t-tests (paired or unpaired) for two groups, ANOVA for multiple groups

    • For non-parametric data: Mann-Whitney U test, Kruskal-Wallis test

    • For repeated measures: Repeated measures ANOVA or mixed-effects models

    • For survival/developmental timing: Kaplan-Meier analysis with log-rank test

  • Multiple hypothesis testing correction:

    • Apply Bonferroni correction for conservative approach

    • Use false discovery rate methods (Benjamini-Hochberg) for genomic/proteomic data

    • Consider family-wise error rate control for related experiments

  • Presentation of statistical results:

    • Report both effect sizes and p-values

    • Include confidence intervals where appropriate

    • Use standardized visualization approaches (box plots with individual data points, not just bar graphs)

    • Present raw data in supplementary materials when possible

Statistical analysis should be conducted using established software packages such as R, GraphPad Prism, or SPSS, with methods clearly described in the methodology section .

How can I integrate multi-omics data to understand the functional role of DDB_G0288661?

Multi-omics approaches provide comprehensive insights into protein function:

  • Data collection strategies:

    • Perform transcriptomics (RNA-seq) comparing wild-type and knockout cells

    • Implement proteomics to identify changes in protein abundance and interactions

    • Consider metabolomics to detect biochemical pathways affected

    • Apply phosphoproteomics to identify altered signaling networks

  • Data integration approaches:

    • Use pathway enrichment analysis across multiple data types

    • Apply network analysis to identify functional modules affected

    • Implement machine learning for pattern recognition across datasets

    • Consider Bayesian integration methods for disparate data types

  • Visualization techniques:

    • Create integrated pathway maps highlighting multi-level changes

    • Develop heatmaps with hierarchical clustering across experiments

    • Use dimension reduction techniques (t-SNE, UMAP) for complex datasets

    • Implement Circos plots for genome-wide data integration

  • Functional validation:

    • Select key findings from integrated analysis for targeted validation

    • Design experiments addressing specific hypotheses generated from data integration

    • Consider epistasis experiments with related pathway components

    • Implement small-molecule modulators of identified pathways to verify relationships

Results should be presented as integrated pathway diagrams with color-coded changes across different omics layers, accompanied by tables summarizing key affected processes with statistical significance measures .

What are the most promising future research directions for understanding DDB_G0288661 function?

Based on our current understanding of transmembrane proteins in Dictyostelium and the methodologies discussed:

  • Structural biology approaches:

    • Cryo-electron microscopy for full-length protein structure

    • X-ray crystallography of soluble domains

    • NMR for dynamic regions and ligand interactions

  • Systems biology integration:

    • Network analysis to position DDB_G0288661 in cellular pathways

    • Synthetic biology approaches to engineer novel functions

    • Comparative analysis across Dictyostelium species for evolutionary insights

  • Translation to mammalian systems:

    • Identification and characterization of mammalian orthologues

    • Heterologous expression in mammalian cells to assess conserved functions

    • Disease relevance assessment if mammalian orthologues exist

  • Advanced imaging techniques:

    • Super-resolution microscopy for nanoscale localization

    • Single-molecule tracking for dynamic behavior analysis

    • Correlative light and electron microscopy for ultrastructural context

These approaches should be prioritized based on initial findings from the foundational characterization studies outlined in previous sections, with an emphasis on collaborative, interdisciplinary research to fully elucidate the biological role of this uncharacterized protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.