Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288997 (DDB_G0288997)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0288997; Putative uncharacterized transmembrane protein DDB_G0288997
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0288997
Target Protein Sequence
MESMNNQEILNGTIEYVSRSSKLLKKVSDITKEKIKDYPYLDDLTEEYIQAQHLYDRTPK LLKLLSEINITDAIISNEVIENINNMKYELDHLIESTQFRIDDIDTYFKRVETEYFLKDK KNEFYVELSSYNSQIQDSLKKLKSIYDGGKLLTKEVSEINRKKFKNSDKVLTKHINTGIA LFIILTSLLVYFIQFKPKISQD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What genetic approaches are most effective for studying DDB_G0288997 in D. discoideum?

D. discoideum offers exceptional genetic tractability for studying uncharacterized transmembrane proteins like DDB_G0288997. Both reverse and forward genetics approaches can be employed effectively. The organism's haploid nature means mutants can be immediately obtained by homologous recombination, allowing direct phenotypic analysis without complications from dominant alleles .

For gene disruption, standard homologous recombination with a linearized plasmid carrying a selection marker (commonly blasticidin resistance) flanked by sequences homologous to the target gene is the method of choice. This approach typically yields complete loss-of-function mutants when properly designed .

For random mutagenesis approaches, restriction enzyme-mediated integration (REMI) is highly effective. This process involves:

  • Linearizing a bacterial plasmid carrying a selection marker (blasticidin)

  • Electroporating the construct with a restriction enzyme into D. discoideum cells

  • Selecting transformants with blasticidin and screening for phenotypes

  • Identifying the disrupted gene by plasmid rescue methods

For targeted mutagenesis of specific domains within DDB_G0288997, site-directed mutagenesis followed by expression in knockout backgrounds provides robust functional assessment options.

How can developmental expression of DDB_G0288997 be monitored throughout the D. discoideum life cycle?

Monitoring expression of DDB_G0288997 throughout development requires consideration of D. discoideum's unique life cycle transition from single-cell amoebae to a multicellular fruiting body. Northern blot analysis using synchronized development on nitrocellulose filters remains a reliable method for examining temporal expression patterns .

For more quantitative assessment:

  • Collect cells at various developmental time points (0, 4, 8, 12, 16, 20, and 24 hours)

  • Extract total RNA using standard TRIzol methods

  • Perform quantitative RT-PCR with primers specific to DDB_G0288997

  • Normalize expression against housekeeping genes (commonly actin or GAPDH)

For protein-level expression analysis, generate DDB_G0288997 antibodies or create GFP fusion constructs. The latter approach can simultaneously reveal both expression patterns and subcellular localization throughout development. When designing fusion constructs, consider both N-terminal and C-terminal tagging strategies, as transmembrane topology may impact proper folding and localization .

What are the essential considerations when designing knockout constructs for DDB_G0288997?

When designing knockout constructs for DDB_G0288997, several critical factors must be considered to ensure efficient targeting and complete functional disruption:

  • Homology arms should be 500-1000 bp each and designed carefully to avoid disrupting adjacent genes

  • Selection markers should include a strong promoter functional in D. discoideum (commonly actin15 promoter)

  • Confirm knockout by both genomic PCR and RT-PCR to verify gene disruption

  • For transmembrane proteins like DDB_G0288997, consider domain-specific disruptions rather than complete gene deletion if studying particular functional domains

A methodological table for knockout generation:

StepApproachConsiderations
DesignIdentify unique regions of DDB_G0288997Avoid homology with other genes
ConstructionClone homology arms into vector with selection markerMaintain reading frame for marker expression
TransformationElectroporation of linearized constructOptimize conditions: 0.8-1.0 kV, 25 μF capacitance
SelectionCulture in media with blasticidin (10 μg/ml)Allow 7-10 days for colonies to emerge
VerificationGenomic PCR, Southern blot, RT-PCRUse primers spanning integration site
Phenotypic analysisGrowth, development, subcellular processesCompare to wild-type controls

This systematic approach ensures complete functional characterization of DDB_G0288997 through proper gene targeting and verification methods .

How can the subcellular localization and trafficking of DDB_G0288997 be determined?

As a putative transmembrane protein, determining the subcellular localization of DDB_G0288997 is critical for understanding its function. Multiple complementary approaches should be employed:

  • Fluorescent protein tagging: Generate C-terminal and N-terminal GFP fusions, being mindful that the tag position can affect trafficking. Express these constructs in both wild-type and knockout backgrounds to assess localization and potential artifacts .

  • Subcellular fractionation: Separate cellular compartments through differential centrifugation and detect the native protein using specific antibodies. For transmembrane proteins in D. discoideum, include membrane solubilization steps using detergents like Triton X-100 or digitonin.

  • Co-localization studies: Use established organelle markers for endoplasmic reticulum (e.g., calnexin), Golgi apparatus, endosomes, and plasma membrane to determine precise localization through confocal microscopy.

For dynamic trafficking analysis, combine these approaches with:

  • Pulse-chase experiments using photoactivatable fluorescent proteins

  • Treatment with trafficking inhibitors (Brefeldin A for Golgi trafficking)

  • Live cell imaging during key developmental transitions

Looking at examples from other D. discoideum studies, components of the γ-secretase complex (PsenB, Ncst, and Aph1) were localized to the endoplasmic reticulum using fluorescent tagging approaches, consistent with mammalian localization patterns . Similarly, when human α-synuclein was expressed in D. discoideum, it localized to the cell cortex, with this localization attributed to the 20 most C-terminal residues .

What approaches can identify potential interaction partners of DDB_G0288997?

Identifying interaction partners provides crucial insights into the functional networks of uncharacterized proteins like DDB_G0288997. Several complementary approaches are recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express DDB_G0288997 with an affinity tag (FLAG, HA, or His) in D. discoideum. After crosslinking and membrane solubilization with appropriate detergents, perform pull-down experiments followed by mass spectrometry identification of co-purified proteins.

  • Proximity labeling: Use BioID or APEX2 fusions to DDB_G0288997 to biotinylate proximal proteins in living cells, followed by streptavidin purification and mass spectrometry.

  • Yeast two-hybrid screening: While challenging for transmembrane proteins, modified membrane yeast two-hybrid systems can be employed using the soluble domains of DDB_G0288997.

  • Co-immunoprecipitation validation: Confirm high-confidence interactions using reciprocal co-immunoprecipitation with tagged constructs.

Data analysis should include:

Analysis StepMethodPurpose
Primary filteringCompare to negative controlsRemove background contaminants
Network analysisSTRING, CytoscapeVisualize interaction networks
GO term enrichmentDAVID, PANTHERIdentify functional clusters
Evolutionary conservationOrtholog analysisAssess conservation of interactions

When interpreting results, consider that transmembrane protein interactions are often underrepresented in standard interactome studies due to technical challenges in membrane protein solubilization and detection .

How can functional conservation between DDB_G0288997 and potential human homologs be assessed?

Assessing functional conservation between D. discoideum DDB_G0288997 and potential human homologs involves a multi-faceted approach combining computational, genetic, and biochemical methods:

  • Sequence-based analysis:

    • Perform sensitive homology detection using PSI-BLAST, HHpred, or AlphaFold2

    • Analyze domain architecture and transmembrane topology conservation

    • Identify conserved motifs and post-translational modification sites

  • Complementation studies:

    • Express the human homolog in DDB_G0288997-null D. discoideum

    • Assess rescue of mutant phenotypes during growth and development

    • Generate chimeric proteins with swapped domains to identify functionally conserved regions

  • Developmental phenotyping:

    • Compare developmental defects with those observed in human cell models

    • Utilize developmental assays specific to D. discoideum such as streaming, aggregation, and fruiting body formation

The complementation approach has proven particularly valuable, as demonstrated in studies of presenilin proteins in D. discoideum. The developmental block observed in presenilin-null mutants was rescued by expression of human Psen1 protein, confirming functional homology between the human and D. discoideum proteins . This approach can be directly applied to DDB_G0288997 if human homologs are identified.

For clear phenotypic assessment, document rescue using the following parameters:

Phenotypic ParameterNull MutantRescue with Human HomologQuantification Method
Growth ratePotentially alteredRestoration to wild-typeDoubling time calculation
Developmental timingPotentially delayedRestoration to wild-typeTime to reach specific stages
Fruiting body morphologyPotentially aberrantRestoration to wild-typeMorphometric analysis
Subcellular processesPotentially disruptedRestoration to wild-typeSpecific assays based on localization

This comprehensive approach provides robust evidence for functional conservation across evolutionary distance .

What expression systems are most appropriate for recombinant production of DDB_G0288997?

For recombinant production of DDB_G0288997, the expression system choice depends on your experimental goals. Three primary systems merit consideration:

  • Homologous expression in D. discoideum:

    • Advantages: Native post-translational modifications and folding environment; suitable for functional studies

    • Vectors: pDXA (extrachromosomal) or pDEX (integrating) series with actin15 promoter

    • Selection: G418 or blasticidin resistance

    • Yield: Typically lower than heterologous systems but physiologically relevant

    • Method: Electroporation of circular plasmid DNA followed by selection

  • Bacterial expression (E. coli):

    • Recommended primarily for soluble domains rather than full-length transmembrane protein

    • Vectors: pET series with T7 promoter, preferably with fusion tags (SUMO, MBP) to enhance solubility

    • Considerations: May require refolding from inclusion bodies; lacks eukaryotic post-translational modifications

  • Insect cell expression (Sf9/Sf21):

    • Advantages: Eukaryotic folding machinery; higher yields than D. discoideum

    • Vectors: Baculovirus expression systems with polyhedrin or p10 promoters

    • Particularly suitable for structural studies requiring larger protein quantities

Expression optimization parameters:

ParameterD. discoideumE. coliInsect Cells
Temperature22°C16-30°C27°C
InductionConstitutive or tet-regulatedIPTG (0.1-1 mM)Viral infection (MOI 1-10)
Harvest time48-72 hours3-16 hours post-induction48-72 hours post-infection
Cell lysisSonication or detergentSonication or pressureDetergent or mechanical
DetergentsTriton X-100, DDM, CHAPSDDM, LDAODDM, GDN, LMNG

For functional studies, homologous expression in D. discoideum provides the most physiologically relevant system, while heterologous systems may be preferred for structural studies requiring higher protein yields .

What purification strategies are recommended for DDB_G0288997 as a transmembrane protein?

Purifying transmembrane proteins like DDB_G0288997 requires specialized approaches to maintain protein stability and function throughout the process. A systematic purification workflow includes:

  • Membrane preparation:

    • Lyse cells by sonication or nitrogen cavitation in buffer containing protease inhibitors

    • Remove unbroken cells and debris by low-speed centrifugation (1,000 × g)

    • Collect membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization optimization:

    • Screen multiple detergents for efficiency: DDM, LMNG, GDN, or CHAPS

    • Typical conditions: 1% detergent, 150-300 mM NaCl, pH 7.4-8.0, 1 hour at 4°C

    • Evaluate solubilization efficiency by Western blot

    • Remove insoluble material by ultracentrifugation (100,000 × g for 30 minutes)

  • Affinity purification:

    • For tagged constructs: Ni-NTA (His-tag), anti-FLAG, or Strep-Tactin resins

    • Maintain detergent above critical micelle concentration in all buffers

    • Include brief washes with higher salt (500 mM) to reduce non-specific binding

    • Elute with specific competitors (imidazole, FLAG peptide, or desthiobiotin)

  • Polishing steps:

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Optional ion exchange chromatography for further purification

Quality control assessment:

Analysis MethodPurposeAcceptance Criteria
SDS-PAGEPurity assessment>90% purity
Western blotIdentity confirmationSingle band at expected MW
Size exclusionMonodispersitySymmetric peak, minimal aggregation
Mass spectrometrySequence verification>80% sequence coverage
Functional assayActivity confirmationActivity comparable to native protein

For structural studies, consider detergent exchange to amphipols, nanodiscs, or SMALPs which provide more native-like membrane environments and enhanced stability for downstream applications .

How can I assess the role of DDB_G0288997 in development and cell differentiation?

Investigating the developmental functions of DDB_G0288997 requires a multifaceted approach leveraging D. discoideum's unique life cycle. The following methodological framework is recommended:

  • Developmental time course analysis:

    • Grow DDB_G0288997-null and wild-type cells to log phase

    • Wash and plate on non-nutrient agar at 5 × 10^6 cells/cm²

    • Document development by time-lapse photography at 2-hour intervals

    • Assess timing of key transitions: streaming, mound formation, slug stage, and culmination

  • Cell-type specific marker analysis:

    • Utilize established markers for prestalk (ecmA, ecmB) and prespore (pspA) cells

    • Perform in situ hybridization or create dual reporter strains with cell-type specific promoters

    • Quantify proportions of cell types using flow cytometry or confocal microscopy

    • Compare with wild-type proportions to identify differentiation defects

  • Chimeric development assays:

    • Mix GFP-labeled knockout cells with unlabeled wild-type cells at varying ratios

    • Track cell fate and sorting using confocal microscopy

    • Determine whether DDB_G0288997-null cells show preferences for specific tissues

    • Assess ability of knockout cells to participate in proper morphogenesis

  • Signaling pathway analysis:

    • Examine response to key developmental signals (cAMP, DIF-1)

    • Measure production of and response to DIF-1 in monolayer assays

    • Assess cAMP relay by analyzing expression of ACA and cAR1

    • Determine if developmental defects can be rescued by exogenous factors

This approach is informed by studies of other D. discoideum proteins. For example, analysis of polyketide synthase StlB showed specific defects in prestalk B cell differentiation resulting in abnormal basal disc and lower cup formation in fruiting bodies . Similarly, dmtA-null mutants showed reduced prestalk O cells in slugs .

Quantitative assessment table:

Developmental ParameterMethodExpected Phenotype if DDB_G0288997 Involved
Timing of aggregationTime-lapse imagingDelayed or accelerated streaming
Mound size and numberImage analysisAltered mound morphology
Slug migrationPhototaxis and thermotaxis assaysDirectional movement defects
Prestalk/prespore ratioCell-type specific markersAltered cell type proportions
Fruiting body morphologyStereomicroscopyAbnormal stalk, sorus, or basal disc

This comprehensive assessment will reveal whether DDB_G0288997 functions in specific developmental processes or cell-type differentiation pathways .

How can mitochondrial function be assessed when studying DDB_G0288997?

If DDB_G0288997 is suspected to affect mitochondrial function, comprehensive assessment methods are essential for phenotypic characterization. This is particularly relevant as several D. discoideum proteins associated with neurological disorders show mitochondrial phenotypes when disrupted .

  • Respiratory function analysis:

    • Employ Seahorse XF Analyzer to measure oxygen consumption rate (OCR)

    • Assess key parameters: basal respiration, ATP production, maximal respiration, and spare capacity

    • Compare knockout strains to wild-type controls under identical conditions

    • Challenge cells with mitochondrial inhibitors (oligomycin, FCCP, rotenone/antimycin A)

  • Mitochondrial morphology:

    • Visualize mitochondria using MitoTracker dyes or mitochondrially-targeted fluorescent proteins

    • Analyze network parameters: fragmentation, elongation, branching complexity

    • Perform live cell imaging to assess dynamic changes

    • Quantify morphological parameters using specialized software (e.g., MiNA, MitoGraph)

  • Membrane potential measurement:

    • Use potential-sensitive dyes (TMRM, JC-1) to assess mitochondrial membrane potential

    • Perform flow cytometry for population-level analysis

    • Conduct live imaging for single-cell dynamics

    • Include CCCP controls to establish baseline for depolarized mitochondria

  • Mitochondrial protein import:

    • Assess import efficiency of reporter constructs

    • Analyze processing of mitochondrial targeting sequences

    • Examine stability of imported proteins

Comparative analysis table based on previous D. discoideum studies:

ParameterObservation in MutantsPossible Interpretation if Seen in DDB_G0288997 Mutants
Elevated OCRObserved in DJ-1 knockdown and α-synuclein expressing strainsCompensatory response to inefficient respiration
Unchanged OCRObserved in A53T α-synuclein expressing strainsFunction might not directly impact respiratory chain
Altered morphologyCommon in mitochondrial dysfunctionPrimary role in mitochondrial structure or dynamics
Fruiting body defectsSeen in HTRA protease-dead strainsSecondary consequence of mitochondrial dysfunction

This analytical framework has successfully identified mitochondrial phenotypes in D. discoideum models of Parkinson's disease, where expression of human α-synuclein caused elevated mitochondrial respiration parameters .

What are the best approaches for studying protein-protein interactions involving DDB_G0288997 in their native membrane environment?

Studying protein-protein interactions of transmembrane proteins like DDB_G0288997 in their native membrane environment presents unique challenges that require specialized approaches:

  • In situ proximity labeling:

    • Generate DDB_G0288997 fusions with proximity labeling enzymes (BioID2, TurboID, or APEX2)

    • Express in D. discoideum under native promoter control

    • Activate labeling (biotin for BioID/TurboID or H₂O₂ for APEX2)

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures transient and stable interactions in the native membrane

  • Cross-linking mass spectrometry (XL-MS):

    • Treat intact cells with membrane-permeable crosslinkers (DSS, BS3)

    • Purify DDB_G0288997 complexes under denaturing conditions

    • Identify crosslinked peptides by specialized MS methods

    • Map interaction interfaces at amino acid resolution

    • Validate with site-directed mutagenesis of interaction interfaces

  • Co-immunoprecipitation with membrane-compatible detergents:

    • Test panel of detergents (digitonin, CHAPS, LMNG) for optimal complex preservation

    • Perform immunoprecipitation with antibodies against native protein or epitope tags

    • Analyze co-precipitated proteins by Western blot or mass spectrometry

    • Include appropriate controls (IgG, unrelated membrane protein)

  • Förster resonance energy transfer (FRET):

    • Generate DDB_G0288997 fusions with fluorescent proteins (mTurquoise/SYFP2 pair)

    • Express with potential interaction partners similarly tagged with complementary fluorophores

    • Measure FRET efficiency using acceptor photobleaching or fluorescence lifetime imaging

    • Quantify interaction strength in living cells

Methodological considerations table:

MethodStrengthsLimitationsBest Application
Proximity labelingCaptures transient interactions; works in native conditionsNon-specific labeling; requires optimizationDiscovering novel interaction partners
XL-MSProvides structural information; captures direct interactionsComplex data analysis; requires abundant materialMapping interaction interfaces
Co-IPWell-established; can be quantitativeMay disrupt weak interactionsConfirming suspected interactions
FRETReal-time analysis in living cells; spatial informationLimited to fluorescently tagged proteinsStudying dynamics of known interactions

These complementary approaches provide a comprehensive strategy for characterizing the interactome of DDB_G0288997 while maintaining the native membrane environment, critical for understanding transmembrane protein function .

What emerging technologies could enhance future studies of DDB_G0288997?

Emerging technologies offer promising new avenues for investigating uncharacterized proteins like DDB_G0288997 in D. discoideum with unprecedented precision and insight:

  • CRISPR-Cas9 genome editing:

    • Enables precise gene editing beyond traditional knockout approaches

    • Allows introduction of point mutations to study specific residues

    • Facilitates tagging at endogenous loci for physiological expression levels

    • Enables multiplexed editing to study genetic interactions with related proteins

  • Cryo-electron microscopy:

    • Provides high-resolution structural information of membrane proteins

    • Can reveal protein complexes in near-native states

    • Requires less protein than X-ray crystallography

    • Can be combined with crosslinking for validation of interaction interfaces

  • Single-cell transcriptomics/proteomics:

    • Reveals cell-type specific expression patterns during development

    • Identifies compensatory responses to protein deletion

    • Enables trajectory analysis during differentiation

    • Can identify regulatory networks controlling expression

  • Optogenetics and chemogenetics:

    • Allows temporal control of protein function

    • Can target specific subcellular compartments

    • Enables study of acute vs. chronic loss of function

    • Facilitates dissection of complex phenotypes

These technologies can be integrated to create a comprehensive understanding of DDB_G0288997 function, as demonstrated by studies of other D. discoideum proteins where multi-faceted approaches have revealed complex functional roles in development and cellular physiology .

How can results from DDB_G0288997 studies be translated to human disease models?

Translating findings from DDB_G0288997 studies in D. discoideum to human disease contexts requires systematic approaches that bridge evolutionary distance while leveraging conserved cellular mechanisms:

  • Homology-based extensions:

    • Identify human homologs through sensitive sequence and structural prediction tools

    • Determine if mutations in human homologs are associated with disease states

    • Express human homologs in DDB_G0288997-null backgrounds to assess functional conservation

    • Create D. discoideum models with disease-associated mutations found in human homologs

  • Pathway conservation analysis:

    • Map DDB_G0288997 into conserved cellular pathways

    • Determine if pathway perturbations mirror human disease mechanisms

    • Focus on fundamental processes highly conserved between D. discoideum and humans

  • Therapeutic target validation:

    • Use D. discoideum as a platform for rapid compound screening

    • Validate hits in mammalian cell models and disease models

    • Leverage the simplicity of D. discoideum for mechanism-of-action studies

This translational approach has proven successful with other D. discoideum proteins. For example, studies of presenilin proteins demonstrated functional conservation with human homologs, providing insights into Alzheimer's disease mechanisms . Similarly, expression of human α-synuclein in D. discoideum created a model system for studying synucleinopathies, revealing cytotoxic phagocytosis defects and mitochondrial dysfunction relevant to Parkinson's disease .

The value of D. discoideum for neurological disorder research is particularly noteworthy, as demonstrated by multiple studies showing conserved cellular functions despite the organism's evolutionary distance from humans .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.