Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0290203 (DDB_G0290203)

Shipped with Ice Packs
In Stock

Description

Expression System

This recombinant protein is expressed in E. coli, with an N-terminal His tag for affinity chromatography purification . Key production parameters include:

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE validated)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

Potential Functional Roles

While the protein’s function remains uncharacterized, its transmembrane nature suggests roles in:

  1. Cell Signaling: Mediating extracellular signals via membrane receptors .

  2. Transport: Facilitating ion or substrate movement across membranes .

  3. Developmental Processes: Dictyostelium undergoes morphogenesis, and transmembrane proteins often regulate developmental stages .

Gene Annotation

DDB_G0290203 is annotated in Dictyostelium genomic databases, including:

  • dictyBase: Centralized resource for Dictyostelium genomic data .

  • Franke Reference Library: Includes developmental and functional annotations .

Transcriptional Regulation

Transcriptional studies in Dictyostelium highlight stage-specific expression patterns, though DDB_G0290203 has not been explicitly linked to developmental milestones .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0290203; Putative uncharacterized transmembrane protein DDB_G0290203
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0290203
Target Protein Sequence
MENSNNTNIFIIFLSFLMIVLSITSIELPWQRIFLSGKFLGMKIFDLTVDHELFDSGIYY PTRLNEVWIEITSNSINNGIMTCMGINILSLVIILINPFKRFFKFISDSHYLFIEKILIR SLSVMIVIFYILSTTIGLMLSGTYCQVTKSSFDSTDGSTLSDESCYSLDMFSKSHIQDLV IRSTEVSSKPMKGWYLSIVLLFLSLILAVMVFIRFKRISPKLVDLGYRHYLTNNKSSSNN DTGSEVIGLSSNESDNIATVEIEPLL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a research model?

Dictyostelium discoideum is a haploid social soil amoeba that has been established as an important host model for studying various pathogens including Pseudomonas aeruginosa, Cryptococcus neoformans, Mycobacterium species, and Legionella pneumophila . Its value as a research model stems from several key features: it has a fully sequenced genome, offers genetic tractability for easy manipulation, and contains numerous orthologs of human genes associated with various disorders . The organism allows researchers to explore fundamental cellular processes due to its well-characterized cell signaling pathways and the availability of host cell markers . Additionally, Dictyostelium has proven useful for studying neurological disorders including Alzheimer's disease, Parkinson's disease, and Huntington's disease, despite not having a nervous system itself .

How is the recombinant DDB_G0290203 protein typically expressed and purified?

The recombinant DDB_G0290203 protein is typically expressed in E. coli expression systems. The full-length protein (amino acids 1-266) is commonly fused to an N-terminal His tag to facilitate purification . Following expression, the protein can be purified using affinity chromatography techniques that leverage the His tag, such as immobilized metal affinity chromatography (IMAC).

After purification, the protein is often provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For reconstitution and storage, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being most common) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

What approaches can be used to functionally characterize the DDB_G0290203 protein?

For functionally characterizing the uncharacterized DDB_G0290203 protein, researchers should consider a multi-faceted approach:

  • Sequence-based prediction analysis: Utilize bioinformatics tools to predict transmembrane domains, signal peptides, and functional motifs. The protein's sequence suggests multiple transmembrane domains that could provide initial insights into its cellular localization and potential function .

  • Gene knockout studies: Create null mutants in Dictyostelium using homologous recombination or CRISPR-Cas9 techniques. Dictyostelium's genetic tractability makes it particularly valuable for these studies . Phenotypic analysis of the mutants during both vegetative growth and multicellular development could reveal the protein's role in various cellular processes.

  • Proteomic and transcriptomic profiling: Compare protein expression levels between wild-type and knockout strains under different conditions, particularly during development when cAMP signaling is active. Similar approaches have been successful in identifying developmentally regulated proteins in Dictyostelium .

  • Fluorescent protein tagging: Create fusion proteins with fluorescent tags to determine subcellular localization. This approach has been successfully used in Dictyostelium to localize γ-secretase complex components to the endoplasmic reticulum .

  • Protein-protein interaction studies: Identify binding partners through co-immunoprecipitation or yeast two-hybrid assays to place the protein within cellular pathways.

What are the optimal conditions for expressing soluble recombinant DDB_G0290203 protein?

When expressing transmembrane proteins like DDB_G0290203, solubility can be challenging. Based on general practices for membrane protein expression and the specific information about this protein, researchers should consider:

  • Expression system optimization:

    • E. coli has been successfully used to express this protein

    • Consider testing different E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta strains) which may improve expression of membrane proteins

    • Alternative systems like insect cells or yeast expression systems might yield better solubility for functional studies

  • Induction conditions:

    • Lower temperatures (16-20°C) during induction often improve membrane protein folding

    • Test various IPTG concentrations (0.1-1.0 mM) and induction durations

    • Consider auto-induction media which can improve yields

  • Solubilization strategies:

    • Include detergents appropriate for membrane proteins (DDM, LDAO, or Triton X-100)

    • Test different detergent concentrations to optimize extraction

  • Buffer composition:

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for storage

    • Include glycerol (5-50%) to stabilize the protein structure

  • Fusion tags:

    • The N-terminal His tag has been successful

    • Consider testing other solubility-enhancing tags like MBP or SUMO if solubility issues arise

How can DDB_G0290203 be studied in the context of host-pathogen interactions?

Dictyostelium discoideum has been established as a host model for several pathogens including Pseudomonas aeruginosa, Cryptococcus neoformans, Mycobacterium species, and Legionella pneumophila . To investigate whether DDB_G0290203 plays a role in host-pathogen interactions:

  • Infection assays with knockout strains: Generate DDB_G0290203 knockout strains and assess their susceptibility to various pathogens compared to wild-type controls. Measure key parameters including:

    • Bacterial uptake rates

    • Intracellular bacterial survival

    • Phagosomal maturation

    • Host cell survival rates

  • Localization during infection: Create GFP-tagged versions of DDB_G0290203 and track its localization during infection using live-cell imaging. Determine if it relocates to phagosomes or other infection-relevant compartments.

  • Comparative analysis with human homologs: Identify potential human homologs through bioinformatic approaches and investigate whether equivalent proteins in human cells play similar roles during pathogen infection of mammalian cells.

  • Transcriptomic response: Utilize RNA-Seq to compare the transcriptional response to infection between wild-type and DDB_G0290203 knockout cells to identify altered pathways.

  • Rescue experiments: Perform complementation studies by expressing either wild-type DDB_G0290203 or site-directed mutants in knockout strains to identify critical functional domains for host-pathogen interactions.

What approaches can be used to determine the structural characteristics of DDB_G0290203?

Determining the structure of membrane proteins like DDB_G0290203 presents unique challenges. Consider these methodological approaches:

  • Computational structure prediction:

    • Utilize AlphaFold2 or RoseTTAFold to generate predicted structures

    • Perform molecular dynamics simulations to analyze the protein's behavior in a membrane environment

    • Use these predictions to guide experimental structure determination

  • X-ray crystallography:

    • Optimize protein purification to achieve high purity (>95%)

    • Screen various detergents to identify those that maintain protein stability and facilitate crystallization

    • Test lipidic cubic phase crystallization methods, which are often successful for membrane proteins

    • Consider creating fusion constructs with crystallization chaperones like T4 lysozyme

  • Cryo-electron microscopy:

    • Particularly valuable for membrane proteins resistant to crystallization

    • Optimize sample preparation with appropriate detergents or reconstitution into nanodiscs

    • Consider single-particle analysis for structural determination

  • NMR spectroscopy:

    • Most suitable for smaller domains of the protein

    • Requires isotopic labeling (15N, 13C) during expression

    • Can provide dynamic information about protein movements

  • Limited proteolysis combined with mass spectrometry:

    • Identify stable domains that might be amenable to structural studies

    • Map exposed regions versus protected transmembrane regions

How do you analyze proteomic data to identify interaction partners of DDB_G0290203?

To identify interaction partners of DDB_G0290203 through proteomic analysis, consider the following systematic approach:

  • Sample preparation:

    • Create cell lines expressing tagged versions of DDB_G0290203 (His-tag or alternative affinity tags)

    • Perform crosslinking before lysis to capture transient interactions

    • Use appropriate detergents for membrane protein solubilization

    • Include proper controls (untagged strains, irrelevant tagged proteins)

  • Affinity purification:

    • Optimize conditions to maintain protein-protein interactions

    • Perform tandem affinity purification for higher specificity

    • Include washing steps that remove non-specific binders while preserving genuine interactions

  • Mass spectrometry analysis:

    • Use both data-dependent acquisition (DDA) and data-independent acquisition (DIA) for comprehensive coverage

    • Perform label-free quantification or SILAC labeling for quantitative comparison

  • Data processing pipeline:

    • Filter identified proteins using statistical significance thresholds

    • Compare with control samples to eliminate common contaminants

    • Apply tools like SAINT (Significance Analysis of INTeractome) for scoring interactions

    • Consider using the approach from search result where filtering includes proteins with values in at least 14 out of 24 samples

  • Bioinformatic analysis:

    • Perform Gene Ontology enrichment analysis on identified proteins

    • Construct protein-protein interaction networks

    • Compare with known interactomes of related proteins

    • Validate key interactions through orthogonal methods (co-IP, FRET, etc.)

How can transcriptomic and proteomic approaches be integrated to understand DDB_G0290203 function during development?

Integration of transcriptomic and proteomic data provides a comprehensive understanding of protein function during development. For DDB_G0290203, consider this workflow:

  • Experimental design:

    • Compare wild-type and DDB_G0290203 knockout strains

    • Collect samples at multiple developmental timepoints (0h, 4h, 8h, 12h, 16h, 20h, 24h)

    • Perform both RNA-Seq and quantitative proteomics on the same samples

  • Data collection and processing:

    • For transcriptomics: Perform RNA-Seq with sufficient depth (>20M reads per sample)

    • For proteomics: Use iTRAQ or TMT labeling for quantitative comparison

    • Process data using established bioinformatic pipelines

  • Integrative analysis approaches:

    • Perform correlation analysis between transcript and protein levels

    • Identify cases of post-transcriptional regulation (disparities between mRNA and protein changes)

    • Use methods similar to those described in search result , where proteomic and transcriptomic profiling were combined to identify developmentally regulated proteins in Dictyostelium

    • Determine if the observed overlap of 70% between protein and transcript changes in wild-type cells is maintained in the DDB_G0290203 knockout

  • Pathway and network analysis:

    • Use enrichment analysis to identify affected pathways

    • Construct gene regulatory networks

    • Apply machine learning approaches to identify regulatory patterns

  • Validation experiments:

    • Confirm key findings with targeted approaches (qRT-PCR, Western blotting)

    • Use reporter gene assays to validate regulatory relationships

    • Perform phenotypic rescue experiments

What are common challenges in studying transmembrane proteins like DDB_G0290203 and how can they be addressed?

Transmembrane proteins present several unique challenges in experimental studies:

  • Protein expression issues:

    • Challenge: Low expression levels or inclusion body formation

    • Solution: Optimize expression conditions (temperature, induction time, media); use specialized E. coli strains designed for membrane proteins; consider eukaryotic expression systems; use fusion tags that enhance solubility

  • Protein purification difficulties:

    • Challenge: Poor solubilization and aggregation during purification

    • Solution: Screen multiple detergents; optimize detergent concentration; include stabilizing agents like glycerol or specific lipids; consider nanodiscs or amphipols for maintaining native-like environment

  • Structural characterization limitations:

    • Challenge: Difficulty obtaining crystals or suitable samples for structural studies

    • Solution: Consider alternative methods like cryo-EM; focus on stable domains; use computational predictions to guide experimental design

  • Functional assay development:

    • Challenge: Difficulty establishing relevant functional assays

    • Solution: Use computational predictions to guide assay design; focus on protein-protein interactions; leverage the Dictyostelium model system's unique advantages for studying development and chemotaxis

  • Localization determination:

    • Challenge: Distinguishing specific localization from overexpression artifacts

    • Solution: Use endogenous tagging approaches; validate with antibody staining when possible; use multiple tags of different sizes to confirm consistent localization

How can conflicting data between different experimental approaches studying DDB_G0290203 be reconciled?

When facing conflicting data about DDB_G0290203 from different experimental approaches, consider this systematic reconciliation strategy:

  • Methodological assessment:

    • Examine the strengths and limitations of each technique

    • Consider if the approaches measure different aspects of the protein's biology

    • Evaluate the reliability and reproducibility of each method

  • Experimental conditions comparison:

    • Analyze differences in experimental conditions (developmental stage, growth conditions, etc.)

    • Standardize conditions across approaches when possible

    • Consider if the protein behaves differently under different conditions

  • Validation experiments:

    • Design experiments specifically to address the contradictions

    • Use orthogonal approaches that can provide clarity

    • Consider using CRISPR-Cas9 to tag the endogenous protein for more physiologically relevant studies

  • Integrated data analysis:

    • Apply computational approaches to integrate conflicting datasets

    • Look for partial agreement that might suggest conditional functions

    • Use statistical methods to determine the most supported model

  • Collaborative resolution:

    • Engage with other researchers studying similar systems

    • Consider if the contradiction itself reveals something important about protein function

    • Develop new hypotheses that could explain the seemingly conflicting results

What are promising approaches for determining the function of DDB_G0290203 in Dictyostelium development?

Several promising approaches can help elucidate the function of DDB_G0290203 in Dictyostelium development:

  • Developmental phenotyping of knockout strains:

    • Create precise knockout strains using CRISPR-Cas9

    • Perform detailed phenotypic analysis throughout the developmental cycle

    • Quantify key parameters (timing of aggregation, mound formation, slug migration, culmination)

    • Analyze cell type differentiation and proportions using cell-type specific markers

  • Conditional expression systems:

    • Develop inducible expression systems to control protein levels at specific developmental stages

    • Use techniques like the Tet-On/Off system adapted for Dictyostelium

    • Assess the effects of protein depletion or overexpression at precise developmental timepoints

  • Live-cell imaging with fluorescent reporters:

    • Generate cell lines with fluorescently tagged DDB_G0290203

    • Track protein localization and dynamics throughout development

    • Combine with markers for specific organelles or developmental processes

    • Use FRET-based approaches to detect protein-protein interactions in vivo

  • Single-cell transcriptomics:

    • Apply single-cell RNA-Seq to compare wild-type and knockout strains during development

    • Identify cell-type specific effects

    • Map the protein's influence on developmental trajectories

  • Interactome analysis across developmental stages:

    • Perform time-course proteomics to identify stage-specific interaction partners

    • Use BioID or proximity labeling approaches to capture transient interactions

    • Integrate with known developmental signaling pathways

How might findings from DDB_G0290203 research translate to understanding human disease mechanisms?

Research on DDB_G0290203 could provide insights into human disease mechanisms through several translational pathways:

  • Identification of human homologs:

    • Perform comprehensive bioinformatic analyses to identify potential human homologs

    • Evaluate conservation of key domains and motifs

    • Assess if human homologs are associated with disease phenotypes

  • Conserved cellular pathways:

    • Determine if DDB_G0290203 functions in cellular processes conserved between Dictyostelium and humans

    • Many fundamental cellular processes are highly conserved in Dictyostelium, allowing for investigation of underlying cytopathological mechanisms

    • Focus particularly on membrane trafficking, calcium signaling, or developmental signaling pathways

  • Model for transmembrane protein dysfunction:

    • Use insights from DDB_G0290203 to understand general principles of transmembrane protein biology

    • Apply findings to human transmembrane proteins implicated in diseases

    • Develop screening platforms for therapeutic compounds

  • Neurological disorder connections:

    • Explore potential connections to neurological disorders, as Dictyostelium has proven valuable for studying conditions like Alzheimer's disease, Parkinson's disease, and Huntington's disease

    • Investigate if DDB_G0290203 interacts with proteins orthologous to those involved in human neurological disorders

  • Drug discovery applications:

    • Determine if DDB_G0290203 or its pathways could be targeted pharmacologically

    • Develop high-throughput screens in Dictyostelium to identify compounds affecting the protein's function

    • Test if these compounds have similar effects in mammalian systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.