Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291600 (DDB_G0291600)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0291600; Putative uncharacterized transmembrane protein DDB_G0291600
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0291600
Target Protein Sequence
MNTSTTTKSKNKPPKSTPSTFIKIIEFWFYLIQILTVLFSWRVYFLFIDSKKKIENNNNN
DNDNNNTNKNDEKRYLTFKEKVQHNFFCLFTDTLYFMMLIITCTLFFWRLKDTLSLLKKS
DSSKYKQIIWDQFSGGFVEFGSFTVLLLLKWPVIFKVFWNKGTEKEDKSTWSQIFMREFS
QEVDKNKLGGPKPPTTNTTNFSGNGSSSSTTNATSSSSSQANNKRAMSDDEWRHAFRRDL
QNIGFEFDSQTGDVSKFPPTEVMEQYQKSAEFRDLILASGSLKAGSEQQDKNKNNNNNNN
NNGPKIEEYDNQKQEEEENEEKETNKQQTQKDDEKETSTTTTSSNKKSKKGKKNKRN
Uniprot No.
Target Background
Database Links
KEGG: ddi:DDB_G0291600
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
