Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0291932 (DDB_G0291932)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Putative Uncharacterized Transmembrane Protein DDB_G0291932 (DDB_G0291932)

Recombinant DDB_G0291932 is a full-length transmembrane protein derived from Dictyostelium discoideum, a model organism for studying cellular differentiation and signaling. The protein remains uncharacterized, with no confirmed functional roles or structural annotations in public databases. Its sequence (UniProt ID: Q54DY5) spans 100 amino acids, with a predicted hydrophobic transmembrane domain suggesting potential roles in membrane signaling or transport .

Sequence and Domain Features

The protein’s sequence (1–100 aa) includes a hydrophobic region (positions 49–68) indicative of a single transmembrane helix . Key features:

ParameterDetail
SequenceMVNDRLYICYCDNGYILIDNTINPYCLLINGSTSPNTTTTIIINNTSNNNNNNNNNHMNW TIPIVIIVSIFILLIIGSISLYLYKKYCSKPKRVHYQLIR
Molecular Weight~11.5 kDa (calculated)
Predicted TopologyType I transmembrane protein (N-terminal cytoplasmic, C-terminal extracellular)

Host System and Engineering

DDB_G0291932 is recombinantly expressed in E. coli with an N-terminal His-tag for purification . Key production details:

ParameterDetail
Host StrainE. coli (BL21(DE3) or proprietary strains)
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based with 6% trehalose, pH 8.0

Challenges in Expression

Transmembrane proteins often face challenges in E. coli due to:

  • Disulfide Bond Formation: Limited in cytoplasmic expression systems .

  • Inclusion Body Formation: Mitigated via strain engineering (e.g., SHuffle™ or SoluB21™ strains) .

Hypothetical Roles

While no experimental data confirm its function, structural homology suggests potential roles:

Hypothesized FunctionEvidence
Membrane SignalingSimilarity to transmembrane receptors in eukaryotic systems .
Transport ActivityPredicted membrane topology aligns with transporter proteins .

Research Gaps

  • Lack of Functional Studies: No reports on ligand binding, enzymatic activity, or interaction partners.

  • Structural Data: No crystallography or cryo-EM structures available .

Potential Uses

ApplicationRationaleSources
Membrane Protein StudiesModel for studying transmembrane helix folding and topology .
Protein EngineeringTesting E. coli expression systems for challenging transmembrane proteins .
Functional ScreeningHigh-throughput assays to identify binding partners or enzymatic activity.

Supplier Overview

SupplierProduct IDPrice (USD)QuantityPuritySources
MyBioSourceMBS7037375$1,515 (0.02 mg)0.02–0.1 mg>85% (SDS-PAGE)
Creative BioMartRFL10296DF$1,3850.02 mg>90% (SDS-PAGE)
CUSABION/A$1,44150 µgN/A

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0291932; Putative uncharacterized transmembrane protein DDB_G0291932
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0291932
Target Protein Sequence
MVNDRLYICYCDNGYILIDNTINPYCLLINGSTSPNTTTTIIINNTSNNNNNNNNNHMNW TIPIVIIVSIFILLIIGSISLYLYKKYCSKPKRVHYQLIR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Dictyostelium discoideum and why is it valuable for studying uncharacterized transmembrane proteins?

Dictyostelium discoideum is a social amoeba that has been utilized for almost a century as an inexpensive and high-throughput model system for studying fundamental cellular and developmental processes. It offers several advantages for investigating transmembrane proteins like DDB_G0291932:

  • Its fully sequenced, low-redundancy genome maintains many genes and signaling pathways found in more complex eukaryotes while providing a less complex system

  • The haploid genome allows researchers to introduce gene disruptions with relative ease, allowing protein function to be studied in a true multicellular organism with measurable phenotypic outcomes

  • Its unique life cycle comprises both unicellular growth and a 24-hour multicellular developmental phase with distinct stages, enabling observation of protein function across different cellular contexts

  • Development shares many features with metazoan development but occurs in a much shorter timeframe, allowing rapid detection of developmental phenotypes

  • The availability of insertional mutant libraries facilitates pharmacogenetic screens that enhance understanding of bioactive compounds at the cellular level

  • What experimental approaches are most effective for initial characterization of an uncharacterized transmembrane protein in Dictyostelium?

Initial characterization of an uncharacterized protein like DDB_G0291932 should employ multiple complementary approaches:

  • Gene expression analysis: Determining temporal and spatial expression patterns throughout the Dictyostelium life cycle using qRT-PCR and RNA-seq

  • Protein localization: Creating GFP/RFP fusion constructs to visualize subcellular localization during growth and different developmental stages

  • Gene disruption: Generating knockout mutants through homologous recombination or CRISPR-Cas9 to assess phenotypic consequences

  • Protein interaction studies: Identifying binding partners through co-immunoprecipitation followed by mass spectrometry analysis

  • Developmental phenotyping: Assessing effects on growth, chemotaxis, aggregation, and multicellular development

Table 1: Experimental Design for Initial Characterization of DDB_G0291932

ApproachMethodologyKey ControlsExpected Outcome
Expression ProfilingqRT-PCR and RNA-seq at different developmental timepointsHouse-keeping genes; known developmentally regulated genesTemporal expression pattern
Subcellular LocalizationC/N-terminal GFP tagging; confocal microscopyFree GFP; known organelle markersMembrane/organelle association
Loss-of-functionCRISPR-Cas9 knockout; phenotypic characterizationWild-type; empty vector controlsDevelopmental defects if functionally significant
Protein InteractionsAP-MS with tagged proteinIgG controls; known interacting proteinsIdentification of protein complexes
Structure PredictionBioinformatic analysis; AlphaFold modelingRelated transmembrane proteinsTopology and functional domain prediction
  • How can researchers determine if DDB_G0291932 plays a role in Dictyostelium development?

To determine the developmental role of DDB_G0291932, researchers should implement a systematic approach:

  • Temporal expression analysis: Measure protein and mRNA levels throughout the 24-hour developmental cycle using Western blotting and qRT-PCR

  • Cell-type specific expression: Use in situ hybridization or reporter constructs to determine if expression is restricted to particular cell types during development

  • Knockout phenotyping: Generate gene disruption mutants and assess developmental progression, focusing on timing of aggregation, mound formation, slug migration, and culmination

  • Complementation testing: Reintroduce the wild-type gene to confirm that developmental defects are specifically due to loss of DDB_G0291932

  • Epistasis analysis: Create double mutants with genes in known developmental pathways to place DDB_G0291932 in the developmental signaling network

Researchers should pay particular attention to cAMP signaling, as this pathway is crucial for Dictyostelium development. Proteomic and transcriptomic profiling has been successfully used to identify early developmentally regulated proteins in response to cAMP, which could help position DDB_G0291932 within developmental signaling networks .

Advanced Research Questions

  • What strategies can be employed to characterize the topology and structural features of DDB_G0291932?

Characterizing the topology and structure of transmembrane proteins presents unique challenges. For DDB_G0291932, researchers can employ:

  • Computational prediction: Use algorithms like TMHMM, Phobius, and TOPCONS to predict transmembrane segments, combined with AlphaFold2 for structural modeling

  • Epitope mapping: Create constructs with epitope tags in predicted intra/extracellular loops to experimentally verify topology

  • Glycosylation site mapping: Introduce glycosylation sites in predicted extracellular domains as topology reporters

  • Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine and assess accessibility to membrane-impermeable reagents

  • Limited proteolysis: Perform controlled digestion with proteases followed by mass spectrometry to identify exposed regions

Table 2: Structural Analysis Approaches for Transmembrane Proteins

MethodApplication to DDB_G0291932AdvantagesLimitations
Computational PredictionInitial topology mappingRapid, guides experimental designRequires validation
Epitope TaggingExperimental topology verificationDirectly tests predictionsMay affect protein folding
Protease ProtectionDomain mappingMaps domain boundariesLimited resolution
Cysteine AccessibilityDetailed topology mappingHigh resolutionLabor intensive
Chimeric ConstructsDomain function analysisIdentifies functional regionsMay disrupt native structure
  • How can researchers determine if DDB_G0291932 functions within specific signaling pathways during Dictyostelium chemotaxis?

Chemotaxis is a well-studied process in Dictyostelium, and determining if DDB_G0291932 participates in related signaling requires:

  • Chemotaxis assays: Test DDB_G0291932 knockout cells in under-agarose, Dunn chamber, or microfluidic gradient assays to assess directional movement toward cAMP or folate

  • Signal transduction analysis: Measure PIP3 production, actin polymerization, and MAPK activation in response to chemoattractants

  • Live imaging: Use fluorescently tagged proteins to visualize cytoskeletal dynamics and polarization during chemotaxis

  • Interaction with known components: Test for physical or functional interactions with established chemotaxis proteins like G-protein coupled receptors, RasC/G, PI3K, and TORC2

  • Pharmacological perturbation: Assess sensitivity to inhibitors of known chemotaxis pathways to place DDB_G0291932 within the signaling network

Researchers studying eukaryotic chemotaxis in Dictyostelium have made significant advances using imaging, synthetic biology, and computational analysis to precisely measure the effects of individual molecules on cellular motility and signaling .

  • What comparative genomic approaches can be used to gain insight into the evolutionary conservation and potential function of DDB_G0291932?

To understand the evolutionary context of DDB_G0291932, researchers can apply:

  • Ortholog identification: Use reciprocal BLAST, OrthoMCL, or OMA to identify orthologs across species

  • Phylogenetic analysis: Construct evolutionary trees to determine when the protein emerged and how it diversified

  • Synteny analysis: Examine conservation of genomic context across species to identify functionally related genes

  • Selection pressure analysis: Calculate dN/dS ratios across protein domains to identify regions under purifying or positive selection

  • Domain architecture comparison: Map conserved domains and their arrangement across orthologs to infer functional constraints

Table 3: Evolutionary Conservation Analysis Framework

Analysis LevelMethodsInterpretation for Function
Sequence ConservationMultiple sequence alignment; ConSurf analysisIdentifies critical functional residues
Domain ArchitectureInterPro; SMART; CDD analysisReveals functional modules and their conservation
Phylogenetic DistributionMaximum likelihood trees; Bayesian inferenceTraces evolutionary history and potential functional shifts
Synteny AnalysisComparison of genomic neighborhoodsIdentifies functionally linked genes
Positive SelectionPAML; HyPhy analysis of dN/dS ratiosHighlights adaptively evolving regions
  • How can proteomics and transcriptomics be integrated to understand DDB_G0291932 regulation during Dictyostelium development?

Integrating proteomic and transcriptomic approaches provides comprehensive insights into protein regulation. Based on approaches used for other Dictyostelium proteins, researchers can:

  • Parallel profiling: Simultaneously analyze protein and mRNA levels across developmental time points to identify post-transcriptional regulation

  • Pulse-chase experiments: Use metabolic labeling to track protein synthesis and degradation rates

  • PTM mapping: Apply phosphoproteomics, glycoproteomics, and other PTM enrichment strategies to identify regulatory modifications

  • RNA-protein correlation analysis: Quantify the relationship between transcript and protein abundance to identify regulatory mechanisms

  • Conditional expression studies: Compare expression in different genetic backgrounds or environmental conditions to reveal regulatory inputs

Researchers have successfully combined whole-cell proteome analysis of developed (cAMP-pulsed) wild-type cells with independent transcriptomic analysis to identify developmentally regulated proteins in Dictyostelium, finding substantial overlap (up to 70%) between proteins identified in the two approaches .

Experimental Design Considerations

  • What are the critical variables and controls needed when designing experiments to characterize DDB_G0291932 function?

Rigorous experimental design is essential for reliable characterization of DDB_G0291932. Researchers should consider:

Critical Variables:

  • Cell density during development (affects synchronization)

  • Starvation conditions (buffer composition, pH)

  • Developmental substrate (agar vs. nitrocellulose filters)

  • Temperature and humidity during development

  • Cell strain background (AX2 vs. AX4 can show differences)

  • Expression level of tagged constructs

Essential Controls:

  • Wild-type parental strain processed in parallel

  • Empty vector transformants

  • Multiple independent clones for gene manipulation

  • Rescue experiments with wild-type gene

  • Known mutants with similar processes as benchmarks

Following experimental design principles as outlined in search result , researchers should ensure their experiments include clearly defined independent and dependent variables, appropriate controls, and multiple trials to ensure statistical validity.

  • How can researchers address potential artifacts when studying DDB_G0291932 localization and interactions?

When investigating protein localization and interactions, several artifacts can arise:

  • Overexpression artifacts: Use endogenous tagging or regulated expression systems to maintain physiological protein levels

  • Tag interference: Compare N- and C-terminal tags, and validate with antibodies against the native protein if available

  • Fixation artifacts: Compare live-cell imaging with different fixation protocols

  • Non-specific interactions: Include stringent controls in co-immunoprecipitation experiments (IgG controls, competitor proteins)

  • Cross-linking artifacts: Validate interactions with orthogonal methods (proximity labeling, FRET)

Table 4: Strategies to Minimize Artifacts in Protein Localization Studies

Potential ArtifactPrevention StrategyValidation Approach
Overexpression EffectsUse inducible promoters; knock-in tagsCompare multiple expression levels
Tag-Induced MislocalizationTest different tag positions and typesValidate with immunofluorescence of native protein
Fixation DistortionCompare multiple fixation methodsValidate with live-cell imaging
Developmental VariationPrecisely time and synchronize developmentImage multiple time points
Strain Background EffectsTest in multiple Dictyostelium strainsCompare AX2 and AX4 backgrounds
  • What statistical approaches are appropriate for analyzing phenotypic data from DDB_G0291932 mutant studies?

For robust analysis of phenotypic data, researchers should employ appropriate statistical methods:

  • For continuous measurements (growth rates, chemotaxis speeds):

    • Parametric tests (t-test, ANOVA) if data is normally distributed

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if assumptions aren't met

    • Mixed-effects models for repeated measures with random factors

  • For categorical outcomes (developmental stage reached):

    • Chi-square or Fisher's exact tests for frequency comparisons

    • Ordinal logistic regression for ordered categorical outcomes

  • For time-to-event data (time to aggregation):

    • Survival analysis methods (log-rank test, Cox proportional hazards)

  • Sample size determination:

    • Power analysis based on expected effect sizes from preliminary data

    • Multiple independent experiments to ensure reproducibility

    • Biological replicates (different cell preparations) and technical replicates

Researchers should pre-register their analysis plans to avoid p-hacking and employ corrections for multiple comparisons when necessary.

Advanced Techniques and Applications

  • How can CRISPR-Cas9 genome editing be optimized for studying DDB_G0291932 in Dictyostelium?

CRISPR-Cas9 technology offers powerful approaches for precise genetic manipulation of DDB_G0291932:

  • Guide RNA design considerations:

    • Select targets with minimal off-target potential

    • Target conserved functional domains

    • Design multiple gRNAs to increase editing efficiency

    • Consider codon optimization for Dictyostelium expression

  • Editing strategies:

    • Gene knockout: Complete disruption to assess loss-of-function phenotypes

    • Precise modifications: Introduce point mutations to assess specific amino acid functions

    • Endogenous tagging: Add fluorescent proteins or epitope tags to study localization and interactions

    • Conditional systems: Incorporate inducible elements for temporal control

  • Verification methods:

    • PCR and sequencing of the target locus

    • Western blotting to confirm protein modification/absence

    • Off-target analysis in predicted sites

    • Phenotypic rescue experiments

The haploid genome of Dictyostelium facilitates gene editing since only one allele needs to be modified to observe phenotypic effects .

  • What high-throughput approaches can effectively position DDB_G0291932 within cellular signaling networks?

To map DDB_G0291932 within signaling networks, researchers can employ several high-throughput strategies:

  • Interaction proteomics:

    • BioID or TurboID proximity labeling to identify neighboring proteins

    • Quantitative AP-MS to identify stable interaction partners

    • Crosslinking mass spectrometry to capture transient interactions

  • Functional genomics:

    • CRISPR screens to identify genetic interactions

    • Phosphoproteomics to position within kinase/phosphatase networks

    • Transcriptomics to identify genes regulated downstream

  • Phenotypic profiling:

    • High-content imaging to quantify cellular phenotypes

    • Chemogenetic interaction mapping with drug libraries

    • Single-cell analyses to identify cell-type specific functions

Table 5: Network Mapping Experimental Design

ApproachMethodologyData AnalysisNetwork Integration
Proximity LabelingBioID-DDB_G0291932 fusion expression; streptavidin pulldown; MSSignificance analysis against controlsPrimary and secondary interactome mapping
PhosphoproteomicsGlobal phosphopeptide enrichment in WT vs. knockoutDifferential phosphorylation analysisKinase-substrate prediction
TranscriptomicsRNA-seq in WT vs. knockout at key developmental stagesDifferential expression analysisGene set enrichment analysis
Genetic InteractionCRISPR interference against known pathway componentsEpistasis analysisPathway positioning
  • How can researchers leverage Dictyostelium as a model to study potential roles of DDB_G0291932 orthologs in human disease?

Based on search result , which highlights Dictyostelium as a model for human diseases, researchers can:

  • Identify human orthologs through reciprocal BLAST and phylogenetic analysis

  • Create Dictyostelium mutants mimicking human disease mutations

  • Assess if the mutant phenotypes resemble cellular aspects of human disease

  • Test if human orthologs can rescue Dictyostelium mutant phenotypes

  • Screen compound libraries for molecules affecting mutant phenotypes

  • Validate findings in mammalian cell models

Dictyostelium has already proven valuable for studying diseases including Batten disease, Parkinson's disease, lysosomal storage disorders, acute respiratory distress syndrome, and others . If DDB_G0291932 has orthologs associated with human disease, similar approaches could be applied.

  • What computational approaches can predict the structure and function of DDB_G0291932 in the absence of experimental data?

For uncharacterized transmembrane proteins like DDB_G0291932, computational approaches provide valuable predictions:

These computational predictions can guide experimental design by identifying the most promising hypotheses to test first.

  • How can researchers effectively study the role of DDB_G0291932 in Dictyostelium response to environmental stressors?

Environmental stress response is an important aspect of Dictyostelium biology that might involve DDB_G0291932:

  • Stress induction protocols:

    • Nutrient limitation (different carbon or nitrogen sources)

    • Osmotic stress (sorbitol, salt treatment)

    • Oxidative stress (H₂O₂, paraquat)

    • Temperature stress (heat shock, cold treatment)

    • pH stress (acidic or basic conditions)

  • Phenotypic assays:

    • Cell viability and recovery after stress

    • Stress granule formation

    • Autophagy induction

    • Developmental timing and morphology under stress

    • Gene expression changes using qRT-PCR or RNA-seq

  • Molecular mechanisms:

    • Phosphorylation status in response to stress

    • Protein localization changes under stress conditions

    • Interaction partners specific to stress conditions

    • Comparative analysis with known stress response mutants

Table 6: Environmental Stress Response Experimental Design

Stress TypeApplication MethodReadoutsControls
Nutrient StarvationWash and resuspend in non-nutrient bufferDevelopment timing; gene expressionWild-type cells; known starvation response mutants
Osmotic Stress400mM sorbitol treatmentCell shrinkage; recovery rate; survivalWild-type response; known osmotic stress mutants
Oxidative Stress0.1-1mM H₂O₂Survival curve; antioxidant enzyme inductionCatalase treatment; reference stress-sensitive strains
Temperature Stress30°C incubationHeat shock protein induction; growth rateWild-type at standard temperature (22°C)
pH StressMedia adjusted to pH 5.0 or 8.0Growth rate; gene expression changesBuffered standard media (pH 6.5)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.