Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0292500 (DDB_G0292500)

Shipped with Ice Packs
In Stock

Description

Overview of Dictyostelium discoideum DDB_G0292500

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0292500 is a protein within the cellular slime mold Dictyostelium discoideum for which the precise function has not been fully determined . D. discoideum is a valuable model organism in cell and developmental biology because of its simple life cycle, ease of use, and potential as a source of novel lead compounds for pharmacological and medical research .

Protein Function Prediction

Bioinformatics researchers use protein function prediction methods to assign biological or biochemical roles to proteins, especially those that are poorly studied or predicted based on genomic sequence data . These predictions often rely on data-intensive computational procedures, using information from:

  • Nucleic acid sequence homology

  • Gene expression profiles

  • Protein domain structures

  • Text mining of publications

  • Phylogenetic profiles

  • Phenotypic profiles

  • Protein-protein interaction

The Gene Ontology (GO) Consortium offers a classification of functions, categorized into molecular function, biological process, and cellular component, that researchers can query using a protein name or accession number to retrieve associated GO terms or annotations based on computational or experimental evidence .

Characteristics of DDB_G0292500

DDB_G0292500 is described as a putative uncharacterized transmembrane protein, suggesting it is predicted to be located in the cell membrane and may play a role in transport or signaling processes, but its exact function remains unknown . Transmembrane proteins are proteins that span a cell membrane . They have diverse functions, including transporting molecules across the membrane, acting as receptors for cell signaling, and facilitating cell adhesion .

Importance of Studying Plasma Membrane Proteins in Dictyostelium discoideum

Studies of plasma membrane proteins in Dictyostelium discoideum have revealed two general classes of proteins: high-abundance proteins present in vegetative cells and conserved through development, and low-abundance species expressed in a stage-specific manner . The latter presumably participate in developmentally important functions . Understanding the function of proteins like DDB_G0292500 may provide insights into the molecular mechanisms underlying the various developmental stages of Dictyostelium discoideum .

Protein Structure

Proteins have four levels of structure:

Tools and Databases for Protein Analysis

  • Creative BioMart: Offers DDB_G0292500 proteins for life sciences research .

  • BLAST (Basic Local Alignment Search Tool): Used to identify homologous proteins with known functions .

  • The Gene Ontology (GO) Consortium: Provides a classification of functions, categorized into molecular function, biological process, and cellular component .

  • Protein Data Bank (PDB): A database for the three-dimensional structural data of large biological molecules, such as proteins and nucleic acids .

Challenges in Functional Characterization

A significant challenge in the field is the presence of proteins with unknown functions. A large percentage of SNVs (single nucleotide variations) have unknown structural and functional consequences . This is often due to a lack of experimental data .

Potential Research Directions

Future research directions could include:

  • Expression analysis: Examining when and where the DDB_G0292500 gene is expressed during the Dictyostelium life cycle.

  • Localization studies: Determining the precise location of the protein within the cell.

  • Interaction studies: Identifying other proteins that interact with DDB_G0292500.

  • Mutational analysis: Investigating the effects of mutations in the DDB_G0292500 gene on Dictyostelium development and behavior.

  • Structural determination: Determining the three-dimensional structure of the protein to gain insights into its function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0292500; Putative uncharacterized transmembrane protein DDB_G0292500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0292500
Target Protein Sequence
MTINNSNIQTDLPNSENCDLKNETLNIYFNEPIPIIKHCTNKDTPTNINNNNNNNNNNNN NNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNNNNINFSCNHILPQSALN SGICANSNPTIFLDKFKIIDLRPSGSGAKKGHGFPTIAPMEISHLINENEFSKFMKSFNR VFNYFFLLLFNVVFLIAGIIFPIFISRISILWAVVGSVGIFIIGGIFYCCINKYINGKRV GFISII
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.