Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0293028 (DDB_G0293028)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
DDB_G0293028; Putative uncharacterized transmembrane protein DDB_G0293028
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0293028
Target Protein Sequence
MGKGELELAGFILSEAFDEKAEKEKVEKEKALKEKTEKEKAEKEKAEKEKVEKEKAEKEK AAKEKAAKEKAEREKSKSAVSPATTNQNSNKGNVEKGVAIGVLAGGAVTGVAVGGAYLAD KYIASKAAGAAVNVIELTPIPNAANTANNAAAVSQGSHRWQPLPYYLFNI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable for studying uncharacterized proteins?

Dictyostelium discoideum is a soil-dwelling amoeba discovered in 1935 that has become an important model organism in molecular and cellular biology. It bridges an evolutionary gap between unicellular and multicellular organisms, making it valuable for comparative genomic studies. Its unique life cycle involves both unicellular and multicellular stages, with multicellularity achieved through cellular aggregation via chemotaxis toward cAMP pulses . This organism is particularly useful for studying uncharacterized proteins because it has a relatively simple genomic structure while sharing many conserved cellular processes with higher eukaryotes. Additionally, Dictyostelium is amenable to genetic manipulation, with gene disruption via homologous recombination working at efficiencies up to 90%, allowing for systematic functional analysis of uncharacterized proteins .

What are the predicted structural features of DDB_G0293028?

As a putative transmembrane protein, DDB_G0293028 likely contains hydrophobic domains that anchor it within cellular membranes. Standard prediction algorithms would analyze the amino acid sequence to identify potential membrane-spanning regions, signal peptides, and conserved domains. While specific structural data for this protein is limited, computational analyses would typically identify the number and orientation of transmembrane helices, potential cytoplasmic and extracellular domains, and any recognized protein family motifs. These predictions provide the foundational knowledge needed to design experimental approaches for functional characterization and can be generated using multiple prediction tools to establish consensus models that guide further investigation.

How can researchers initially characterize the expression pattern of DDB_G0293028?

The expression pattern of DDB_G0293028 can be initially characterized through temporal and spatial expression analysis techniques. Researchers would typically employ RT-PCR or RNA-seq to determine when the gene is expressed during the Dictyostelium life cycle. This should be systematically analyzed across the unicellular growth phase, aggregation, mound formation, and culmination stages to identify any developmental regulation . For spatial expression, researchers can generate translational GFP fusion constructs where the DDB_G0293028 gene is fused with GFP while maintaining its endogenous promoter. This approach allows visualization of the protein's expression in different cell types and subcellular compartments during development. Expression data should be presented in tables comparing levels across different developmental time points, with statistical analysis to identify significant changes in expression patterns.

What gene manipulation approaches are most effective for studying DDB_G0293028 function?

For uncharacterized proteins like DDB_G0293028, a comprehensive gene manipulation strategy combining multiple approaches yields the most reliable results. Gene disruption via homologous recombination is particularly effective in Dictyostelium due to its high efficiency (up to 90%) . For DDB_G0293028, researchers should:

  • Generate complete knockout mutants using homologous recombination targeting constructs

  • Create conditional mutants using inducible promoter systems if initial studies suggest the gene might be essential

  • Employ the Cre-loxP system for recycling selection markers if multiple rounds of gene targeting are needed

  • Develop tagged versions of the protein (GFP, FLAG, etc.) for localization and interaction studies

For essential genes where knockout is lethal, antisense or dominant negative constructs under regulatable promoters provide alternatives to study gene function . Data from these various genetic manipulations should be systematically compared using tables that highlight phenotypic differences between wildtype and mutant strains across multiple experimental conditions.

How can researchers optimize the expression and purification of recombinant DDB_G0293028?

Optimizing expression and purification of a transmembrane protein like DDB_G0293028 requires careful consideration of expression systems and detergent conditions. The recommended methodological approach involves:

  • Expression system selection: While E. coli systems are common, transmembrane proteins often require eukaryotic expression systems such as yeast, insect cells, or mammalian cells to ensure proper folding and post-translational modifications.

  • Construct design: Create multiple construct variations with different affinity tags (His, GST, MBP) positioned at either the N- or C-terminus to determine optimal configuration for expression and purification.

  • Solubilization screening: Systematically test a panel of detergents (ranging from harsh ionic detergents to milder non-ionic options) for their ability to solubilize DDB_G0293028 while maintaining structure and function.

  • Purification optimization: Implement a multi-step purification process involving affinity chromatography followed by size exclusion chromatography.

The purification outcomes should be assessed through SDS-PAGE and Western blotting, with results presented in tables comparing protein yields and purity across different expression conditions and detergent formulations. Additional validation of proper folding through limited proteolysis or circular dichroism should be included to ensure the purified protein retains its native structure.

What approaches can resolve protein-protein interaction networks involving DDB_G0293028?

Elucidating the protein interaction network of DDB_G0293028 requires a multi-faceted approach combining complementary techniques. A systematic methodology would include:

  • Immunoprecipitation coupled with mass spectrometry: Using tagged versions of DDB_G0293028 to pull down interacting proteins under different cellular conditions (growth, development, stress).

  • Proximity labeling methods: Employing BioID or APEX2 fusion constructs with DDB_G0293028 to identify proteins in close proximity within living cells.

  • Yeast two-hybrid screening: Modified for membrane proteins using split-ubiquitin systems to identify direct protein-protein interactions.

  • Co-localization studies: Combining fluorescently tagged DDB_G0293028 with markers for cellular compartments to identify spatial associations.

Results should be presented as interaction networks with confidence scores for each interaction, and validated interactions should be highlighted in tables showing the detection method, cellular conditions, and statistical significance of each interaction. This comprehensive approach addresses the limitations of individual methods and provides a more complete understanding of the protein's functional context.

How should researchers design experiments to study DDB_G0293028 during Dictyostelium development?

Designing experiments to study DDB_G0293028 during Dictyostelium development requires careful consideration of the organism's unique life cycle. A comprehensive experimental design should:

  • Establish synchronized development: Using standard starvation protocols to initiate development, collect samples at precise time points (0h, 4h, 8h, 12h, 16h, 20h, 24h) covering the transition from unicellular to multicellular stages.

  • Implement parallel analytical approaches: Combine transcript analysis (RNA-seq or qRT-PCR), protein expression studies (Western blotting), and localization studies (immunofluorescence or live cell imaging with tagged constructs).

  • Compare wildtype and mutant phenotypes: Document developmental progression through photomicroscopy at standardized time points, measuring aggregation efficiency, mound formation, and culmination.

  • Conduct cell-type specific analyses: Use cell-sorting techniques to separate prestalk and prespore cells to determine if DDB_G0293028 shows cell-type specificity during development .

Results should be presented in tables comparing expression levels and localization patterns across developmental stages, with statistical analysis to identify significant changes. Additionally, microscopy images showing developmental phenotypes of wildtype versus mutant strains should be systematically documented and quantified.

What controls and validation steps are essential when studying an uncharacterized protein like DDB_G0293028?

  • Multiple independent mutant strains: Generate and analyze at least three independent knockout or knockdown lines to rule out off-target effects or insertional artifacts.

  • Rescue experiments: Complement mutant phenotypes with wild-type protein expression to confirm specificity of observed defects.

  • Tag control experiments: When using tagged proteins, compare multiple tag positions (N-terminal, C-terminal) and types (small epitope tags vs. fluorescent proteins) to ensure tag placement doesn't interfere with function.

  • Antibody validation: For custom antibodies against DDB_G0293028, validate specificity using knockout strains as negative controls and overexpression strains as positive controls.

  • Phenotype specificity tests: Demonstrate that observed phenotypes are specific to DDB_G0293028 disruption rather than general stress responses by comparing to phenotypes of unrelated gene disruptions.

Results from these validation experiments should be systematically documented and presented in comparison tables highlighting differences between experimental and control conditions, with appropriate statistical analysis to determine significance levels.

How should researchers analyze transcriptomic data to identify pathways affected by DDB_G0293028 disruption?

Analysis of transcriptomic data from DDB_G0293028 mutants requires a systematic bioinformatic approach to identify affected pathways while distinguishing direct from indirect effects. The recommended methodology includes:

  • Quality control and normalization: Apply rigorous quality filtering of raw RNA-seq data followed by appropriate normalization methods to account for library size and composition biases.

  • Differential expression analysis: Use statistical packages like DESeq2 or edgeR to identify significantly differentially expressed genes (DEGs) between wildtype and DDB_G0293028 mutants.

  • Temporal analysis: For developmental studies, implement time-course analysis to identify genes with altered expression patterns rather than just absolute differences at single time points.

  • Pathway enrichment analysis: Apply Gene Ontology (GO) and pathway analysis to identify biological processes and functions enriched among DEGs.

  • Network analysis: Construct gene co-expression networks to identify modules of coordinately regulated genes affected by DDB_G0293028 disruption.

Results should be presented in clear tables showing the most significantly affected pathways, with fold changes and adjusted p-values. Additionally, heat maps displaying expression patterns of key genes across conditions provide visual representation of complex data patterns . This structured analysis helps distinguish between primary effects directly linked to DDB_G0293028 function and secondary consequences of its disruption.

What statistical approaches are recommended for analyzing phenotypic data from DDB_G0293028 mutants?

  • Experimental design optimization: Ensure sufficient biological replicates (minimum n=3, preferably n≥5) and technical replicates to power statistical analyses.

  • Appropriate statistical tests: Select tests based on data distribution and experimental design:

    • For normally distributed continuous data: t-tests or ANOVA with post-hoc tests

    • For non-normally distributed data: non-parametric alternatives (Mann-Whitney U or Kruskal-Wallis)

    • For developmental timing data: survival analysis methods

    • For categorical phenotype data: chi-square or Fisher's exact tests

  • Multiple testing correction: Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) when performing multiple comparisons to control false discovery rate.

  • Effect size reporting: Include not only p-values but also effect sizes and confidence intervals to indicate biological significance.

Results should be presented in well-formatted tables with consistent decimal places and units for measurements . Statistical significance can be indicated with asterisks or other symbols in the tables, with explanations in footnotes, rather than including separate columns for p-values . This approach ensures both statistical rigor and clarity in data presentation.

How can researchers distinguish between direct and indirect effects in DDB_G0293028 functional studies?

Distinguishing direct from indirect effects in functional studies of uncharacterized proteins like DDB_G0293028 requires a multi-faceted experimental approach. The recommended methodology includes:

  • Acute vs. chronic disruption comparison: Compare phenotypes from inducible systems (allowing acute protein depletion) with constitutive knockout models to identify immediate versus adaptive effects.

  • Time-course analyses: Implement detailed temporal studies to identify the earliest detectable molecular and cellular changes following protein disruption.

  • Direct binding studies: Utilize techniques like ChIP-seq (for DNA interactions) or CLIP-seq (for RNA interactions) if the protein is suspected to interact with nucleic acids, or proximity labeling for protein interactions.

  • Structure-function analyses: Generate a series of point mutations or domain deletions to map specific functional regions and correlate molecular interactions with cellular phenotypes.

  • Rescue experiments with heterologous proteins: Test whether homologs from other species can rescue phenotypes to identify evolutionarily conserved direct functions versus species-specific indirect effects.

Results should be presented in comprehensive tables that categorize effects as likely direct or indirect based on multiple lines of evidence, with confidence levels assigned based on consistency across different experimental approaches. This systematic approach helps build a more accurate model of DDB_G0293028's true biological function.

What are the optimal imaging techniques for localizing DDB_G0293028 during different developmental stages?

Imaging an uncharacterized transmembrane protein like DDB_G0293028 during Dictyostelium development requires specialized techniques to achieve adequate resolution and specificity. The recommended methodological approach includes:

  • Confocal microscopy with deconvolution: For basic localization studies, using spinning disk or laser scanning confocal microscopy with deconvolution algorithms to improve resolution of membrane structures.

  • Super-resolution techniques: Implementing STED, PALM, or STORM microscopy to resolve nano-scale organization within membrane domains when standard confocal resolution is insufficient.

  • Live cell imaging optimizations:

    • Photobleaching minimization using oxygen scavengers

    • Reduced laser power with longer exposure times

    • Selection of appropriate fluorophores with brightness and photostability suited to Dictyostelium's autofluorescence profile

  • 3D reconstruction of multicellular structures: Using Z-stack acquisition with appropriate step sizes (0.3-0.5μm) to visualize protein distribution throughout multicellular structures during development.

  • Co-localization analysis: Combining DDB_G0293028 imaging with established markers for cellular compartments (plasma membrane, endosomes, Golgi, etc.) using quantitative co-localization metrics.

Images should be presented with appropriate scale bars, consistent processing parameters, and quantitative analysis of localization patterns across developmental stages. Detailed imaging parameters (exposure times, laser powers, filter sets) should be provided in table format to ensure reproducibility of the imaging approach.

How can researchers address the challenges of membrane protein crystallization for structural studies of DDB_G0293028?

Membrane protein crystallization presents significant challenges that require specialized methodological approaches. For structural studies of DDB_G0293028, researchers should implement:

  • Construct optimization: Create multiple truncated versions of the protein to remove disordered regions while preserving core transmembrane domains:

    • Test N- and C-terminal truncations systematically

    • Consider replacing flexible loops with well-characterized stable domains

    • Generate fusion constructs with crystallization chaperones like T4 lysozyme

  • Detergent screening: Conduct extensive screening of detergents and detergent mixtures using a stability-based approach:

    • Employ thermal shift assays to identify conditions promoting protein stability

    • Test classic detergents (DDM, OG) alongside newer amphipols and nanodiscs

    • Consider lipid addition to stabilize native-like environments

  • Crystallization screening: Implement specialized membrane protein crystallization approaches:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle-based crystallization

    • Vapor diffusion with detergent-specific optimizations

  • Alternative structural methods:

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for smaller domains or fragments

    • Cross-linking mass spectrometry to obtain distance constraints

Results from crystallization trials should be presented in systematic tables comparing protein stability, homogeneity, and diffraction quality across different construct designs and crystallization conditions. This methodical approach maximizes the chances of obtaining structural information for challenging membrane proteins like DDB_G0293028.

How can contradictory results from different functional assays of DDB_G0293028 be reconciled?

Contradictory results in functional studies of uncharacterized proteins are common and require systematic reconciliation. When faced with conflicting data about DDB_G0293028 function, researchers should:

  • Assay condition comparison: Systematically document and compare all experimental conditions between contradictory assays, including:

    • Growth media composition and cell density

    • Developmental induction methods

    • Buffer compositions and pH values

    • Temperature and timing variations

  • Strain background analysis: Evaluate whether genetic background differences might explain contradictory results:

    • Compare auxotrophic markers in different strains

    • Sequence verify the targeted locus in all strains

    • Consider performing whole-genome sequencing to identify potential second-site mutations

  • Method-specific artifacts assessment: Identify potential artifacts specific to each method:

    • Expression level differences in overexpression studies

    • Tag interference in localization studies

    • Off-target effects in gene disruption approaches

  • Integrated data analysis: Develop models that might explain apparent contradictions:

    • Context-dependent protein functions

    • Temporal dynamics not captured in steady-state analyses

    • Compensatory mechanisms activated in some conditions but not others

Results from this reconciliation process should be presented in comprehensive comparison tables that document methodological differences between contradictory studies and propose specific hypotheses to explain discrepancies, with designed experiments to test these hypotheses explicitly.

What are the most promising research directions for further characterizing DDB_G0293028 function?

Based on current knowledge of Dictyostelium biology and transmembrane protein functions, the most promising research directions for further characterizing DDB_G0293028 include:

  • Comparative genomics and evolution:

    • Identify homologs across evolutionary diverse species

    • Analyze conservation patterns to identify functionally critical domains

    • Perform complementation studies with homologs to determine functional conservation

  • Interaction proteomics in developmental context:

    • Implement BioID or APEX2 proximity labeling during different developmental stages

    • Identify condition-specific interaction partners during growth versus development

    • Construct dynamic interaction networks reflecting temporal changes in protein associations

  • High-resolution localization during development:

    • Apply super-resolution microscopy to track protein dynamics during key developmental transitions

    • Correlate subcellular localization changes with known developmental signaling events

    • Implement FRAP (Fluorescence Recovery After Photobleaching) to analyze protein mobility in different developmental contexts

  • Functional domain mapping:

    • Generate a systematic library of point mutations and truncations

    • Correlate structural features with specific cellular phenotypes

    • Identify minimal functional domains for key activities

These research directions should be pursued in parallel, with data integration strategies that combine findings from different approaches to build comprehensive models of DDB_G0293028 function. Research progress should be documented in tables that track how each approach contributes to understanding different aspects of the protein's biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.