Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 1 (DDB_G0276997)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0276997; Putative ZDHHC-type palmitoyltransferase 1; Zinc finger DHHC domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0276997
Target Protein Sequence
MSRPSYASATKTYFHNRLVTGPDRAYFIVAMILMLIPEIPFLIFVCPLFEEWITAAIYPV SIYFWIASYIFLIQTAYTDPGIIPRGIYNDDIFAPDHRQPLFKKITVKDTKQEIKWCETC CLYRPPRANHCGICNNCVERFDHHCPWVGNCIGRRNYQTFLYFLYSLGFLCIWIMGFCVA HICIESARYRDNHPSASSAKVFQEGMNKSHYISDYNYSLWVSRFNSNPYRKSAFANFIEA FCPPRYPSFYKYTLDHEKELTTIPTPNNINGNNNNSINNNNNNNNNNNNNNNNNNNNNNN NNNINNGNSGGTTNNGYTPPISPPQMLQRQSSTIRYSLDNLRTSSNSSLGNFNNLKSSRD LNLSTISEDKPKNLSNSNNNNNTNNKNTSEDNNHSSGSDFGGDEENNEDDFKSDNDKEIN SSSLSLNHELQVNV
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 1?

The Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 1 (DDB_G0276997) belongs to the ZDHHC family of enzymes responsible for catalyzing S-palmitoylation, a reversible post-translational lipid modification. Like other ZDHHC enzymes, it is likely characterized by a four-pass transmembrane domain architecture containing two CCHC zinc fingers in proximity to the DHHC catalytic site within the cytoplasmic loop. The catalytic mechanism involves auto-S-palmitoylation at the active site cysteine, which serves as the necessary initial step in protein S-palmitoylation. This auto-activation process is facilitated by a conserved hydrophobic cavity that positions the fatty acyl moiety of fatty acyl-CoA adjacent to the thiol sidechain of the active site cysteine .

How does the auto-S-palmitoylation process in ZDHHC enzymes influence experimental design when studying DDB_G0276997?

When designing experiments to study DDB_G0276997, researchers must account for the critical auto-S-palmitoylation process that activates the enzyme. This initial transthioesterification of the active site cysteine by fatty acyl-CoA serves as the essential first step in ZDHHC-mediated protein S-palmitoylation. Experimental protocols should incorporate methods to assess this activation step independently from subsequent substrate palmitoylation. Recent methodological advances utilize fluorescent NBD-palmitoyl-CoA in native membrane environments to monitor activation without requiring enzyme purification, which can compromise physiological relevance. When studying DDB_G0276997, researchers should design experiments that maintain the enzyme in its native membrane context to preserve authentic activation characteristics .

What are the recommended approaches for generating functional recombinant DDB_G0276997 for in vitro studies?

For generating functional recombinant DDB_G0276997, researchers should implement an expression system that maintains the enzyme's native membrane environment. Based on established protocols for other ZDHHC enzymes, overexpression of hemagglutinin (HA)-tagged wild-type or mutant versions in cultured cells (such as HEK293) followed by preparation of whole membrane fractions is recommended. This approach preserves the enzyme's native lipid environment and associated regulatory factors.

The experimental workflow should include:

  • Cloning the DDB_G0276997 gene into an appropriate expression vector with an epitope tag

  • Transfection into a eukaryotic expression system

  • Membrane fraction preparation via ultracentrifugation

  • Verification of expression via Western blotting

  • Assessment of activity using NBD-palmitoyl-CoA followed by SDS-PAGE and fluorescence imaging

This method circumvents limitations associated with purified systems that remove the enzyme from its native membrane context, potentially altering its catalytic properties and physiological relevance .

How might differential palmitoylation states of DDB_G0276997 influence its catalytic activity and substrate specificity?

The dynamic palmitoylation state of DDB_G0276997 likely creates distinct enzyme species with varying catalytic properties and substrate affinities. Based on findings from human ZDHHC enzymes, DDB_G0276997 may undergo palmitoylation at multiple cysteine residues beyond the active site, creating a complex landscape of differentially modified enzyme species. Each palmitoylation state potentially exhibits unique turnover rates, substrate preferences, and regulatory properties.

Experimental data from human ZDHHC6 demonstrates that palmitoylation at three conserved cysteines in its SH3 domain creates eight possible species with distinct functional characteristics. These species rapidly interconvert through the action of upstream palmitoyltransferases and thioesterases, allowing cells to precisely tune enzyme activity. For DDB_G0276997, researchers should employ site-specific mutagenesis coupled with kinetic parameter determination to characterize how each palmitoylation state influences catalytic function and substrate selection .

What is the significance of potential hierarchical palmitoylation cascades involving DDB_G0276997 in Dictyostelium discoideum?

Recent evidence in human systems has revealed the existence of palmitoylation cascades where one ZDHHC enzyme regulates another through palmitoylation, as demonstrated with ZDHHC16 controlling ZDHHC6. When investigating DDB_G0276997, researchers should explore whether it participates in similar hierarchical regulation within Dictyostelium discoideum. Such cascades could represent a sophisticated regulatory mechanism allowing precise temporal and spatial control of protein palmitoylation networks during Dictyostelium development and chemotaxis.

To determine if DDB_G0276997 is involved in a palmitoylation cascade, researchers should:

  • Identify potential regulatory ZDHHC enzymes using co-immunoprecipitation and proximity labeling techniques

  • Characterize palmitoylation sites through mass spectrometry following Acyl-RAC or click chemistry-based purification

  • Perform knockdown/knockout studies of candidate regulatory enzymes to assess their impact on DDB_G0276997 palmitoylation status and activity

  • Develop mathematical models to describe the dynamic interconversion between differentially palmitoylated species

This multi-faceted approach would elucidate whether DDB_G0276997 functions as a regulatory node within a broader palmitoylation network .

How does the substrate specificity of DDB_G0276997 compare across evolutionary lineages, and what are the implications for functional conservation?

The evolutionary conservation and divergence of substrate specificity for DDB_G0276997 represents a critical area for comparative biochemical analysis. While the core DHHC catalytic domain shows conservation across eukaryotes, substrate recognition regions likely underwent lineage-specific adaptations.

Researchers investigating this question should implement:

  • Phylogenetic analysis of ZDHHC enzymes across diverse eukaryotic lineages

  • Heterologous expression of DDB_G0276997 in different cellular backgrounds (yeast, mammalian cells)

  • Substrate profiling using proteomics approaches in native and heterologous systems

  • Chimeric enzyme construction to identify substrate specificity determinants

Evolutionary LineagePredicted Substrate ConservationKey Structural FeaturesRegulatory Mechanisms
AmoebozoaCore developmental substratesExtended N-terminal domainCell cycle-coupled regulation
FungiBasic cellular machinery substratesCompact SH3 domainStress-responsive regulation
MetazoaSpecialized signaling proteinsVariable C-terminal extensionsTissue-specific expression patterns
PlantsLimited functional overlapDivergent transmembrane organizationEnvironmental response coupling

This evolutionary perspective provides crucial context for understanding the functional adaptations of DDB_G0276997 in Dictyostelium discoideum and its potential utility in heterologous experimental systems .

What are the optimal conditions for assessing DDB_G0276997 auto-S-palmitoylation in native membranes?

For assessing DDB_G0276997 auto-S-palmitoylation in native membranes, researchers should adopt a protocol based on established methods for human ZDHHC enzymes, with modifications tailored to Dictyostelium biochemistry. The recommended procedure includes:

  • Expression of epitope-tagged DDB_G0276997 in Dictyostelium cells

  • Preparation of membrane fractions via differential centrifugation

  • Incubation of membranes with fluorescent NBD-palmitoyl-CoA (5-10 μM) in buffer containing 50 mM HEPES (pH 7.4), 150 mM NaCl, and 1 mM TCEP

  • Reaction termination by addition of SDS sample buffer

  • Analysis via SDS-PAGE followed by fluorescence imaging and Western blotting

Critical parameters include:

  • Temperature: 25-30°C (optimized for Dictyostelium proteins)

  • Incubation time: 10-30 minutes (determined empirically)

  • Detergent concentration: 0.1% digitonin (to maintain native membrane structure)

  • pH range: 6.5-7.5 (to reflect Dictyostelium cytoplasmic conditions)

This approach provides a facile means to assess enzyme activation in its native membrane environment without requiring protein purification that might compromise physiological relevance .

How can researchers design appropriate controls to distinguish between active site auto-S-palmitoylation and palmitoylation at other cysteine residues in DDB_G0276997?

To distinguish between active site auto-S-palmitoylation and palmitoylation at other cysteine residues in DDB_G0276997, researchers should implement a comprehensive mutational analysis strategy. Based on methodologies applied to other ZDHHC enzymes, the following experimental approach is recommended:

  • Identify all cysteine residues in DDB_G0276997 through sequence analysis

  • Generate the following mutant constructs:

    • Active site cysteine mutant (DHHC→DHHA)

    • Single cysteine mutants for non-catalytic cysteines

    • Combinatorial mutants (double, triple, etc.)

    • Complete cysteine-free mutant

  • Assess palmitoylation of each mutant using:

    • Metabolic labeling with 3H-palmitate

    • Click chemistry with alkyne-palmitate

    • Acyl-RAC or acyl-biotin exchange methods

The active site mutant serves as the primary negative control, while the pattern of palmitoylation across the mutant series will reveal which cysteines undergo modification. Additionally, researchers should compare palmitoylation kinetics across mutants to distinguish between auto-catalytic and trans-catalytic mechanisms. Time-course experiments can further differentiate between primary (rapid) active site labeling and secondary (slower) modification at other sites .

What experimental design considerations are necessary for investigating potential upstream regulators of DDB_G0276997 activity?

When investigating potential upstream regulators of DDB_G0276997 activity, researchers should implement a true experimental design that incorporates appropriate controls and accounts for multiple regulatory mechanisms. Based on the principles of experimental research design and findings from other ZDHHC systems, the following approach is recommended:

  • Candidate regulator identification:

    • Proteomics-based interactome analysis

    • Genetic screening for modulators of DDB_G0276997-dependent phenotypes

    • Bioinformatic prediction of regulatory motifs

  • Validation experiments:

    • Co-immunoprecipitation to confirm physical interactions

    • FRET/BRET assays to assess proximity in live cells

    • Split-luciferase complementation to validate protein-protein interactions

  • Functional assessment:

    • Knockdown/knockout of candidate regulators

    • Overexpression studies with wild-type and dominant-negative versions

    • Pharmacological inhibition where applicable

  • Mechanistic characterization:

    • Palmitoylation state analysis following regulator manipulation

    • Phosphorylation analysis of DDB_G0276997

    • Subcellular localization studies

This experimental design incorporates both independent variables (regulator manipulation) and dependent variables (DDB_G0276997 activity), with appropriate controls to establish causality rather than mere correlation. The multi-faceted approach increases confidence in identified regulatory relationships by establishing convergent evidence through complementary methodologies .

How should researchers resolve contradictory data regarding DDB_G0276997 substrate specificity when using different experimental approaches?

When confronted with contradictory data regarding DDB_G0276997 substrate specificity from different experimental approaches, researchers should implement a systematic reconciliation strategy. Contradictions frequently arise from methodological differences in substrate presentation, enzyme preparation, or detection sensitivity.

The recommended approach includes:

  • Comprehensive methodological comparison:

    • Create a detailed matrix of experimental variables across studies

    • Identify key differences in buffer conditions, detergent use, temperature, and substrate concentration

    • Evaluate protein expression systems and purification protocols

  • Validation through orthogonal techniques:

    • If in vitro and cellular data conflict, perform in vitro reconstitution with purified components

    • If overexpression and knockdown studies yield discrepancies, employ CRISPR-based genome editing for endogenous protein manipulation

    • Validate using both gain-of-function and loss-of-function approaches

  • Substrate presentation considerations:

    • Test substrate proteins in multiple forms (purified, within membranes, as peptides)

    • Evaluate the impact of substrate post-translational modifications

    • Assess potential co-factor or scaffold protein requirements

  • Quantitative analysis:

    • Determine enzyme kinetics (Km, Vmax) for disputed substrates

    • Compare relative efficiencies between substrates under standardized conditions

    • Apply Bayesian statistical approaches to integrate conflicting datasets

This structured approach allows researchers to identify the source of experimental discrepancies and develop a unified model of DDB_G0276997 substrate specificity that accounts for context-dependent differences in enzyme behavior .

What mathematical modeling approaches are most appropriate for analyzing the dynamic interconversion between differentially palmitoylated DDB_G0276997 species?

For analyzing the dynamic interconversion between differentially palmitoylated DDB_G0276997 species, researchers should implement mathematical modeling approaches that capture both the kinetics of individual reactions and the system-level dynamics. Based on approaches applied to human ZDHHC enzymes, the following modeling strategy is recommended:

  • Model framework selection:

    • Ordinary differential equations (ODEs) for deterministic modeling of concentration changes

    • Stochastic simulation algorithms when considering low-abundance species

    • Rule-based modeling for handling combinatorial complexity of multiple modification sites

  • Parameter estimation:

    • Determine rate constants for auto-palmitoylation through in vitro kinetic assays

    • Measure depalmitoylation rates using pulse-chase experiments

    • Estimate protein turnover rates with cycloheximide chase assays

  • Model validation:

    • Test model predictions against experimental time-course data

    • Perform sensitivity analysis to identify critical parameters

    • Validate with inhibitor studies targeting specific reactions

  • System-level analysis:

    • Assess steady-state distributions of palmitoylated species

    • Identify potential regulatory nodes through perturbation analysis

    • Investigate the emergence of switch-like behavior or oscillations

A specific implementation might include:

dPidt=ji(kjiPj)ji(kijPi)kdeg,iPi+ksynδi,0\frac{dP_i}{dt} = \sum_{j \neq i} (k_{j \rightarrow i} \cdot P_j) - \sum_{j \neq i} (k_{i \rightarrow j} \cdot P_i) - k_{deg,i} \cdot P_i + k_{syn} \cdot \delta_{i,0}

Where PiP_i represents the concentration of DDB_G0276997 species with palmitoylation state i, kjik_{j \rightarrow i} is the rate constant for conversion from state j to state i, kdeg,ik_{deg,i} is the degradation rate, ksynk_{syn} is the synthesis rate, and δi,0\delta_{i,0} is the Kronecker delta function (equals 1 when i=0, 0 otherwise).

This mathematical framework provides a rigorous foundation for understanding the complex dynamics of DDB_G0276997 palmitoylation states and their functional implications .

How can researchers differentiate between direct and indirect effects when analyzing the impact of DDB_G0276997 knockout on global palmitoylation patterns?

Differentiating between direct and indirect effects when analyzing the impact of DDB_G0276997 knockout on global palmitoylation patterns requires a multifaceted experimental approach combined with rigorous data analysis. The challenge stems from potential compensatory mechanisms, cascading effects on other palmitoyltransferases, and alterations in substrate availability.

Researchers should implement the following strategy:

  • Temporal analysis:

    • Utilize inducible knockout/knockdown systems

    • Perform time-course proteomics after DDB_G0276997 depletion

    • Early changes (6-12 hours) likely represent direct effects, while later changes (24-72 hours) may include indirect consequences

  • Substrate validation:

    • Perform in vitro palmitoylation assays with purified DDB_G0276997 and candidate substrates

    • Create substrate mutants lacking putative palmitoylation sites

    • Assess substrate palmitoylation in complementation experiments with catalytically inactive DDB_G0276997

  • Network analysis:

    • Measure activity and expression of other ZDHHC enzymes after DDB_G0276997 depletion

    • Construct hierarchical clustering of palmitoylation changes to identify substrate groups

    • Apply Bayesian network inference to model causal relationships

  • Comparative analysis:

    • Cross-reference palmitoylation changes with known substrate preferences of other ZDHHC enzymes

    • Compare acute inhibition (using small molecules if available) versus genetic depletion

    • Analyze specific versus global palmitoylation changes across cellular compartments

This integrated approach enables researchers to develop a high-confidence list of direct DDB_G0276997 substrates while mapping the broader network effects resulting from its absence, providing crucial insights into its biological functions and regulatory relationships .

What are the key considerations for developing a selective inhibitor of DDB_G0276997 for research applications?

Developing a selective inhibitor of DDB_G0276997 for research applications requires careful consideration of enzyme structure, catalytic mechanism, and species specificity. Based on current understanding of ZDHHC enzymes, researchers should implement the following methodological approach:

  • Structure-based rational design:

    • Generate homology models based on available ZDHHC crystal structures

    • Identify unique features of the DDB_G0276997 active site and substrate binding pocket

    • Design compounds that exploit these distinctive structural elements

  • High-throughput screening strategy:

    • Develop a robust activity assay suitable for compound library screening

    • Create focused libraries targeting the DHHC catalytic motif

    • Implement counter-screening against related ZDHHC enzymes to assess selectivity

  • Compound optimization:

    • Establish structure-activity relationships through systematic modification

    • Optimize for selectivity, cell permeability, and metabolic stability

    • Balance potency with specificity to minimize off-target effects

  • Validation methodology:

    • Confirm direct binding using biophysical methods (thermal shift, ITC, SPR)

    • Verify on-target engagement in cellular contexts via CETSA or related approaches

    • Assess global effects on the palmitome to confirm specificity

  • Control compound development:

    • Create structurally similar but inactive analogs as negative controls

    • Develop compounds with graduated potency for dose-response studies

    • Consider photoactivatable or clickable analogs for target engagement studies

This systematic approach maximizes the likelihood of developing research tools with the selectivity required for reliable interrogation of DDB_G0276997 function in complex biological systems .

How can researchers design experiments to investigate the role of DDB_G0276997 during Dictyostelium development and differentiation?

To investigate the role of DDB_G0276997 during Dictyostelium development and differentiation, researchers should design experiments that capture both loss-of-function phenotypes and the dynamic regulation of enzyme activity throughout the developmental cycle. The following experimental design strategy is recommended:

  • Genetic manipulation approach:

    • Generate CRISPR/Cas9 knockout strains

    • Create conditional expression systems (tetracycline-controlled or similar)

    • Develop site-specific mutants (catalytically inactive, palmitoylation-deficient)

  • Developmental phenotype analysis:

    • Monitor aggregation, slug formation, and fruiting body development

    • Quantify timing and efficiency of each developmental transition

    • Assess cell-type differentiation using specific markers

  • Substrate dynamics investigation:

    • Perform stage-specific palmitome analysis

    • Identify developmentally regulated substrates

    • Track localization changes of key substrates during development

  • Rescue experiments:

    • Complement knockout with wild-type or mutant versions

    • Perform time-specific rescue at distinct developmental stages

    • Test heterologous expression of orthologs from related species

  • Signaling pathway integration:

    • Analyze cAMP response in DDB_G0276997-deficient cells

    • Assess DIF-1 sensitivity and stalk/spore cell fate decisions

    • Investigate potential cross-talk with PKA and GSK3 signaling

Developmental StageExperimental ApproachParameters to MeasureExpected Outcomes
Vegetative GrowthGrowth rate, phagocytosis assaysDoubling time, particle uptakeBaseline cellular functions
Starvation ResponseTime-lapse imaging, RT-qPCRcAMP pulse frequency, expression of early genesInitial aggregation competence
AggregationUnder-agarose chemotaxis, ECISDirectional movement, cell-cell adhesionCollective cell behavior
Mound FormationConfocal microscopy, cell sorting assaysCell type proportions, spatial organizationPattern formation capacity
CulminationMorphometric analysis, spore viabilityFruiting body architecture, spore germinationTerminal differentiation

This comprehensive experimental design allows researchers to distinguish between direct effects on developmental signaling versus indirect consequences of altered protein palmitoylation on general cellular functions .

What methodological approaches can resolve discrepancies between in vitro and in vivo assessments of DDB_G0276997 substrate specificity?

Resolving discrepancies between in vitro and in vivo assessments of DDB_G0276997 substrate specificity requires methodological approaches that bridge the gap between controlled biochemical systems and complex cellular environments. Researchers should implement the following strategy:

  • Semi-in vitro systems development:

    • Create semi-permeabilized cell assays that maintain cellular architecture

    • Utilize isolated membrane fractions containing native protein complexes

    • Develop reconstituted proteoliposomes with defined lipid compositions

  • Substrate presentation standardization:

    • Express substrates with consistent tags and purification strategies

    • Test peptide substrates alongside full-length proteins

    • Evaluate the impact of post-translational modifications on substrate recognition

  • In-cell validation techniques:

    • Implement proximity labeling approaches (BioID, APEX) to identify spatially relevant substrates

    • Utilize engineered ZDHHC enzymes with expanded substrate recognition

    • Develop split-protein complementation assays for direct enzyme-substrate interaction assessment

  • Quantitative proteomics integration:

    • Apply multiplexed proteomics (TMT, iTRAQ) to compare substrate changes across conditions

    • Implement targeted proteomics (PRM, SRM) for accurate quantification of specific substrates

    • Develop enrichment strategies optimized for low-abundance palmitoylated proteins

  • Context-dependent analysis:

    • Systematically vary buffer conditions to mimic cellular environments

    • Test substrate competition effects with physiologically relevant protein concentrations

    • Assess the impact of scaffold proteins and co-factors

This methodological framework enables researchers to identify the specific factors responsible for discrepancies between in vitro and in vivo observations, ultimately developing a unified model of DDB_G0276997 substrate specificity that accounts for cellular context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.