Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 2 (DDB_G0274739)

Shipped with Ice Packs
In Stock

Description

Functional Role in S-Acylation

ZDHHC enzymes mediate protein palmitoylation by transferring palmitate from acyl-CoA to cysteine residues. While direct substrate profiles for DDB_G0274739 remain uncharacterized, studies on homologous ZDHHCs (e.g., human ZDHHC20) reveal roles in:

  • Membrane protein trafficking

  • Viral defense (e.g., IFITM3 modification)

  • Lipid metabolism regulation

In D. discoideum, S-acylation likely influences developmental signaling and stress responses, though mechanistic studies are pending .

3.1. Enzyme Activity Assays

The recombinant protein serves as a tool to:

  • Characterize autoacylation kinetics (a hallmark of ZDHHC function) .

  • Screen inhibitors or modulators of palmitoyltransferase activity .

3.2. Substrate Identification

Chemical genetic approaches (e.g., engineered "hole" mutants paired with fatty acid probes) could map DDB_G0274739-specific substrates, as demonstrated for human ZDHHCs .

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles; store aliquots at -80°C .

  • Activity Validation: Use radiolabeled palmitate or fluorescent probes (e.g., YnPal) to assay transferase activity .

  • Antibody Compatibility: Recombinant antibodies against D. discoideum proteins (e.g., phage display-derived tools) may aid in localization studies .

Broader Implications

  • Evolutionary Conservation: D. discoideum shares DNA repair and signaling pathways with humans, making it a tractable model for studying conserved ZDHHC functions .

  • Biomedical Relevance: Dysregulated S-acylation is linked to cancer and neurodegeneration; understanding DDB_G0274739 could reveal therapeutic targets .

Unresolved Questions

  • Substrate Specificity: Does DDB_G0274739 target unique proteins in D. discoideum?

  • Developmental Role: How does S-acylation by this enzyme influence multicellular morphogenesis?

This recombinant protein provides a foundation for addressing these questions, bridging gaps between model organism biology and human disease mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0274739; Putative ZDHHC-type palmitoyltransferase 2; Zinc finger DHHC domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0274739
Target Protein Sequence
MNLYNNSNSSGSSNSSSSSNNKTNIDYNDINNNDILTPKGYHTSIYIDDNDLNNNQIINK NNNNNHNRNNNNNNNNNNNHNNPKKMVINLNPSGIFIPLMNDFDDDDDDEQESLIKNNKI TIPTINSQIAIPILNNNDNNNNSNNKTEQTTTTTTIIKNTTIFNNKTISFGRIGFRSIVI FLILVPYIYILNFAIFPWTVNYETERKGKIHSFISMALVIQMLCNYYLCSTTDPGSFKDT ISPSYYLLHPISSTDSNDHKKWCNKCNHQKPERAHHCRYCNRCVLRMDHHCQWLQNCIGL FNQKYFVLFLFYTSISIIYFFTLLIKRSIELVTKYTMEKTLPSFDLLHLFLLGILIIILI IAGISIMALLWTQIALISKGLTTIEHEDKKRKYQQPNYLNLYKKYDKGSIISNFSIVFGN LSFLWLLPTIPNNLKITSKKGDIFIV
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does DDB_G0274739 structurally compare to mammalian ZDHHC enzymes?

DDB_G0274739 likely shares the conserved structural architecture of ZDHHC palmitoyltransferases found across eukaryotes:

  • Four transmembrane domains

  • A cytoplasmic DHHC-containing catalytic domain

  • Zinc finger domains that are critical for enzymatic function

  • Cytoplasmic N-terminal and C-terminal regions

Based on studies of mammalian zDHHCs, the enzyme likely contains:

  • A catalytic DHHC motif within the cytoplasmic loop between transmembrane domains 2 and 3

  • Two zinc finger domains in the same cytoplasmic loop that maintain the proper configuration of the active site

  • Potential regulatory regions in the cytoplasmic tails

As seen with zDHHC5, disruption of zinc finger motifs leads to loss of function by altering the configuration of the DHHC active site, preventing auto-S-palmitoylation .

What is known about the subcellular localization of Dictyostelium discoideum ZDHHC-type palmitoyltransferase 2?

While specific localization data for DDB_G0274739 is limited in the provided search results, several inferences can be made based on known patterns of ZDHHC enzymes:

  • Mammalian ZDHHC enzymes show distinct subcellular localization patterns, primarily distributing between the endoplasmic reticulum (ER), Golgi apparatus, and plasma membrane

  • ZDHHC6 in mammals is specifically localized to the endoplasmic reticulum

  • Different ZDHHC enzymes in the same organism often exhibit distinct localization patterns, allowing spatial regulation of protein palmitoylation

To determine the precise subcellular localization of DDB_G0274739, researchers should consider:

  • Generating fluorescently-tagged fusion proteins for live-cell imaging

  • Performing subcellular fractionation followed by Western blotting

  • Conducting immunofluorescence studies with specific antibodies

  • Correlating localization with potential substrates to infer functional roles

What are the key domains in DDB_G0274739 and their functional significance?

Based on the conserved structure of ZDHHC palmitoyltransferases, DDB_G0274739 likely contains several functionally significant domains:

  • DHHC catalytic domain: Contains the active site cysteine essential for the two-step palmitoylation reaction:

    • Formation of the acyl-enzyme intermediate through auto-palmitoylation

    • Transfer of the acyl group to substrate proteins

  • Zinc finger domains: Critical for maintaining the proper configuration of the active site. As demonstrated with zDHHC5, mutation of a single cysteine (e.g., Cys123) in the zinc finger domain can completely abrogate auto-S-palmitoylation activity .

  • Transmembrane domains: Four membrane-spanning regions that anchor the enzyme and may contribute to substrate recognition.

  • Cytoplasmic N-terminal and C-terminal tails: May be involved in:

    • Protein-protein interactions

    • Substrate recognition

    • Regulatory post-translational modifications

    • Some zDHHCs (including zDHHC5) have cysteines in these regions that can be palmitoylated, serving as positive allosteric modulators of enzyme activity

How does auto-S-palmitoylation contribute to DDB_G0274739 function?

Auto-S-palmitoylation represents a critical activation step for all ZDHHC palmitoyltransferases:

What experimental approaches can effectively assess the enzymatic activity of recombinant DDB_G0274739?

Several complementary approaches can be used to assess DDB_G0274739 enzymatic activity:

  • Auto-S-palmitoylation assays in native membranes:

    • Express HA-tagged DDB_G0274739 in HEK293 cells

    • Prepare membrane fractions containing the expressed enzyme

    • Incubate with fluorescent NBD-palmitoyl-CoA

    • Analyze by SDS-PAGE followed by fluorescence imaging and Western blotting

  • Click chemistry-based detection:

    • Metabolically label cells expressing DDB_G0274739 with alkyne-fatty acid analogs

    • Perform copper-catalyzed click reaction with azide-linked fluorophores

    • Visualize palmitoylated proteins by in-gel fluorescence or Western blotting

  • Substrate palmitoylation assays:

    • Co-express DDB_G0274739 with potential substrate proteins

    • Measure incorporation of radiolabeled palmitate or detect palmitoylation using click chemistry

    • Compare palmitoylation levels between wild-type and catalytically inactive mutants

  • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC):

    • These techniques can assess palmitoylation status of specific proteins

    • Useful for identifying novel substrates of DDB_G0274739

What strategies should be employed for optimal expression and purification of active recombinant DDB_G0274739?

Successful expression and purification of functional DDB_G0274739 requires careful consideration of:

  • Expression systems:

    • Mammalian cells (HEK293, COS-7): Provide native membrane environment and post-translational modifications

    • Insect cells: Offer good compromise between yield and proper folding

    • Yeast systems: Especially useful if studying enzyme in conjunction with potential yeast orthologs

    • Bacterial systems: Higher yield but may lack proper folding environment for membrane proteins

  • Purification strategies:

    • Detergent solubilization: Critical for extracting membrane-embedded enzymes

    • Affinity tags: His-tag, FLAG-tag, or HA-tag for purification

    • Size exclusion chromatography: To ensure homogeneity

  • Maintaining enzyme activity:

    • Consider using nanodiscs or liposomes to maintain a lipid environment

    • Optimize detergent types and concentrations to preserve activity

    • Include reducing agents to protect critical cysteine residues

    • Perform activity assays at each purification step to track retention of function

  • Alternative membrane preparation approach:

    • Consider using the native membrane assay described in search result

    • This approach maintains the enzyme in its native membrane environment

    • More physiologically relevant than using purified enzyme

    • Overexpress tagged DDB_G0274739 in cultured cells, prepare membrane fractions, and directly assess activity

How can researchers determine the substrate specificity of DDB_G0274739?

Determining substrate specificity requires systematic analysis using various approaches:

  • Proteomics-based identification:

    • Compare palmitoylated proteome profiles between:

      • Cells overexpressing DDB_G0274739

      • Cells expressing catalytically inactive mutant

      • Control cells

    • Use stable isotope labeling (SILAC) for quantitative comparison

    • Apply click chemistry with azide-alkyne cycloaddition for enrichment of palmitoylated proteins

  • Candidate substrate testing:

    • Select potential substrate proteins based on:

      • Known substrates of mammalian ZDHHC enzymes

      • D. discoideum proteins with predicted palmitoylation sites

      • Proteins that function in the same subcellular compartment

    • Measure palmitoylation of candidates in the presence/absence of DDB_G0274739

  • In vitro palmitoylation assays:

    • Purify potential substrate proteins

    • Incubate with membrane fractions containing DDB_G0274739

    • Detect palmitoylation using fluorescent palmitoyl-CoA analogs

    • Compare rates of palmitoylation across different substrates

  • Structural determinants of specificity:

    • Analyze sequence motifs surrounding palmitoylated cysteines

    • Create chimeric constructs to determine regions that confer specificity

    • Perform molecular docking simulations between enzyme and potential substrates

How do mutations in the zinc finger domains affect DDB_G0274739 activity?

Based on studies of mammalian zDHHC enzymes, mutations in zinc finger domains can have profound effects on enzyme function:

  • Complete loss of activity:

    • As demonstrated with zDHHC5, mutation of a single cysteine (Cys123) in the second zinc finger domain completely abolished auto-S-palmitoylation

    • This highlights the critical role of intact zinc finger domains in maintaining active site configuration

  • Experimental approach to study effects:

    • Generate site-directed mutants targeting conserved cysteines in zinc finger domains

    • Express wild-type and mutant proteins in cells

    • Assess auto-S-palmitoylation using the NBD-palmitoyl-CoA assay

    • Examine effects on substrate palmitoylation

  • Structural considerations:

    • Zinc finger domains likely coordinate zinc ions to maintain proper protein folding

    • Mutations disrupt this coordination, leading to conformational changes

    • These changes prevent proper positioning of the active site cysteine for catalysis

  • Potential for partial activity:

    • Some mutations may result in reduced rather than abolished activity

    • Quantitative assays can determine the degree of impairment

    • Correlation between structural changes and activity can provide mechanistic insights

What techniques are most effective for identifying proteins palmitoylated by DDB_G0274739?

Multiple complementary techniques can identify DDB_G0274739 substrates:

  • Click chemistry-based approaches:

    • Culture cells with alkyne-palmitate

    • Click reaction with azide-fluorophores for detection

    • Can be coupled with immunoprecipitation for specific target analysis

    • Example workflow from Badrilla Click S-Palmitoylation Detection Kit:

      • Label cells with palmitic acid analogs

      • Perform click reaction with fluorescent reporters

      • Analyze by SDS-PAGE and fluorescence scanning

  • Acyl-Biotin Exchange (ABE):

    • Block free thiols, cleave thioester bonds, capture newly exposed thiols with biotin

    • Enrich biotinylated proteins for mass spectrometry analysis

    • Compare samples with and without hydroxylamine treatment to identify palmitoylated proteins

  • Metabolic labeling with radiolabeled palmitate:

    • Traditional gold standard for palmitoylation detection

    • Culture cells expressing DDB_G0274739 with [3H]-palmitate

    • Visualize palmitoylated proteins by fluorography

  • Proximity labeling techniques:

    • Fuse BioID or TurboID to DDB_G0274739

    • Identify proteins in close proximity to the enzyme

    • Cross-reference with palmitoylome data to identify potential direct substrates

  • Comparative proteomics:

    • Stable isotope labeling of proteins in control vs. DDB_G0274739-expressing cells

    • Enrich for palmitoylated proteins

    • Identify proteins with altered palmitoylation status by mass spectrometry

How can researchers distinguish between auto-palmitoylation and substrate palmitoylation in experimental systems?

Distinguishing between these two processes requires careful experimental design:

  • Site-directed mutagenesis:

    • Generate catalytic mutants by replacing the active site cysteine with serine

    • These mutants cannot undergo auto-palmitoylation but may still be palmitoylated at other sites

    • Compare palmitoylation patterns between wild-type and mutant enzymes

  • Time-course experiments:

    • Auto-palmitoylation typically occurs rapidly

    • Substrate palmitoylation follows auto-palmitoylation

    • Short pulse-labeling can capture auto-palmitoylation before substantial substrate modification

  • NBD-palmitoyl-CoA assay specificity:

    • Under standard assay conditions, NBD-palmitoyl-CoA specifically labels the active site cysteine

    • This specificity is likely due to the high reactivity of the active site thiol and precise positioning within the acyl-CoA binding channel

    • Confirmed through mutational analysis across multiple zDHHC family members

  • Mass spectrometry approaches:

    • Identify specific palmitoylated residues

    • The active site cysteine in the DHHC motif is the site of auto-palmitoylation

    • Other palmitoylated cysteines represent either regulatory modifications or substrate palmitoylation

What is the evolutionary relationship between Dictyostelium discoideum ZDHHC-type palmitoyltransferases and those in other organisms?

Understanding the evolutionary context of DDB_G0274739 provides insights into conserved functions:

  • Phylogenetic analysis approach:

    • Collect ZDHHC protein sequences from diverse organisms

    • Perform multiple sequence alignment focusing on the DHHC domain and zinc finger regions

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Map functional data onto the phylogenetic framework

  • Functional conservation testing:

    • Express DDB_G0274739 in mammalian or yeast cells lacking specific ZDHHC enzymes

    • Assess complementation of phenotypes

    • Test whether known substrates of mammalian enzymes can be palmitoylated by DDB_G0274739

  • Structural conservation assessment:

    • Compare predicted structural features across diverse organisms

    • Identify conserved motifs beyond the DHHC domain

    • Analyze conservation of regulatory regions and post-translational modification sites

  • Domain architecture comparison:

    • Analyze the organization of functional domains across species

    • Identify lineage-specific adaptations

    • Map domain gains/losses onto the evolutionary tree

What are the advantages of measuring DDB_G0274739 auto-S-palmitoylation in native membranes?

The native membrane assay offers several advantages over purified enzyme approaches:

  • Physiological relevance:

    • Maintains the enzyme in its native lipid environment

    • Preserves interactions with endogenous regulatory proteins

    • Reflects more accurately the in vivo activity of the enzyme

  • Implementation procedure:

    • Express HA-tagged DDB_G0274739 in HEK293 cells

    • Prepare membrane fractions containing the expressed enzyme

    • Incubate with fluorescent NBD-palmitoyl-CoA (10-25 μM)

    • Analyze by SDS-PAGE, fluorescence imaging, and Western blotting for normalization

  • Practical advantages:

    • Avoids time-consuming and potentially activity-compromising purification steps

    • Requires smaller amounts of starting material

    • Enables higher throughput analysis of multiple mutants or conditions

    • Can be applied to most members of the ZDHHC family

  • Optimization strategies:

    • Deplete endogenous acyl-CoA to improve signal-to-noise ratio

    • Perform clarification spin to remove nuclei and cell debris

    • Adjust NBD-palmitoyl-CoA concentration (25 μM for weaker signals)

    • Optimize incubation time (typically 2-5 minutes)

How can Click Chemistry be applied to study protein palmitoylation by DDB_G0274739?

Click Chemistry offers powerful tools for studying protein palmitoylation:

  • Metabolic labeling approach:

    • Culture cells with alkyne-fatty acid analogs (e.g., 17-octadecynoic acid)

    • Express DDB_G0274739 and potential substrate proteins

    • Harvest cells and perform click reaction with azide-fluorophores or azide-biotin

    • Analyze by in-gel fluorescence or Western blotting

  • Workflow details from Badrilla protocol:

    • Add Click Labeling Reagent to cells expressing proteins of interest

    • Incubate for at least 4 hours to allow incorporation

    • Process samples according to the kit protocol

    • Analyze by gel electrophoresis and fluorescence scanning

  • Advantages of click chemistry:

    • Non-radioactive alternative to traditional [3H]-palmitate labeling

    • Higher sensitivity and faster detection than radiography

    • Compatible with mass spectrometry for site identification

    • Can be used for both fixed cell imaging and biochemical analysis

  • Applications to DDB_G0274739 research:

    • Identify novel substrate proteins

    • Visualize subcellular localization of palmitoylated proteins

    • Compare wild-type and mutant enzyme activity

    • Study dynamics of palmitoylation/depalmitoylation cycles

What are the advantages and limitations of using fluorescent palmitoyl-CoA analogs?

Fluorescent analogs like NBD-palmitoyl-CoA offer specific advantages and limitations:

  • Advantages:

    • Direct visualization without secondary detection reagents

    • High sensitivity for detecting auto-S-palmitoylation

    • Specificity for the active site cysteine under standard conditions

    • Compatible with both purified enzymes and native membrane preparations

    • Enables quantitative assessment of enzyme activity

  • Technical implementation:

    • NBD-palmitoyl-CoA contains a fluorescent N-[(7-nitro-2-1,3-benzoxadiazol-4-yl)-methyl]amino palmitoyl group

    • Optimal concentration range: 10-25 μM

    • Short incubation times (2-5 minutes) minimize non-specific labeling

    • Direct visualization by in-gel fluorescence scanning at 775nm

  • Limitations:

    • May not perfectly mimic native palmitoyl-CoA kinetics

    • Fluorophore could potentially affect substrate binding

    • Less suitable for studying substrate palmitoylation than auto-palmitoylation

    • May require optimization for enzymes with lower activity levels

  • Practical considerations:

    • Fluorescent palmitoyl-CoA is light-sensitive; protect from light

    • Store in small aliquots to avoid freeze-thaw cycles

    • Include appropriate negative controls (catalytically inactive mutants)

    • Consider coupling with Western blotting for normalization to expression levels

How can researchers assess the effects of post-translational modifications on DDB_G0274739 function?

Post-translational modifications can significantly impact enzyme function:

  • S-palmitoylation of regulatory cysteines:

    • Some zDHHCs (including zDHHC5) are themselves palmitoylated at sites distinct from the active site

    • This palmitoylation can serve as positive allosteric modulation of enzyme activity

    • Approach: Generate cysteine-to-serine mutations at potential regulatory sites and assess effects on auto-palmitoylation and substrate modification

  • Experimental workflow:

    • Generate mutants lacking potential modification sites

    • Express wild-type and mutant proteins in cells

    • Assess auto-S-palmitoylation using the NBD-palmitoyl-CoA assay

    • Measure substrate palmitoylation efficiency

    • As demonstrated with zDHHC5, mutation of C-terminal palmitoylation sites (e.g., Cys236/237/245) reduces auto-S-palmitoylation efficiency

  • Phosphorylation analysis:

    • Identify potential phosphorylation sites using prediction algorithms

    • Generate phosphomimetic (Ser/Thr to Asp/Glu) and phosphodeficient (Ser/Thr to Ala) mutants

    • Compare activity profiles under different signaling conditions

    • Use phospho-specific antibodies to correlate modification status with activity

  • Mass spectrometry-based approaches:

    • Identify all post-translational modifications on purified enzyme

    • Correlate modification patterns with activity states

    • Use targeted mass spectrometry to monitor specific modifications under different conditions

What expression systems are most suitable for producing functional recombinant DDB_G0274739?

Selecting the appropriate expression system is critical for obtaining functional enzyme:

  • Mammalian cell expression:

    • HEK293 cells have been successfully used for zDHHC enzyme expression

    • Provides native-like membrane environment and post-translational modifications

    • Optimal for functional studies and native membrane assays

    • Transient transfection or stable cell line generation are both viable approaches

  • Dictyostelium discoideum expression:

    • Homologous expression provides the most native environment

    • Useful for in vivo functional studies

    • Can be challenging for large-scale protein production

    • Consider knockout/knockin approaches for functional characterization

  • Insect cell expression:

    • Baculovirus expression system offers higher yields than mammalian cells

    • Maintains most post-translational modifications

    • Good compromise between yield and proper folding

    • Suitable for scaled-up production for biochemical and structural studies

  • Expression optimization factors:

    • Codon optimization for the host organism

    • Signal sequence consideration for proper membrane targeting

    • Addition of purification tags that don't interfere with function

    • Temperature and induction conditions that maximize folding efficiency

What are the key challenges and future directions in DDB_G0274739 research?

Research on DDB_G0274739 faces several challenges and opportunities:

  • Technical challenges:

    • Developing specific antibodies against the native protein

    • Establishing reliable activity assays for high-throughput screening

    • Determining three-dimensional structure given the challenges of membrane protein crystallography

    • Identifying the complete range of physiological substrates

  • Biological questions:

    • Understanding the role of DDB_G0274739 in D. discoideum development and signaling

    • Determining how substrate specificity is achieved and regulated

    • Mapping the dynamic regulation of enzyme activity under different conditions

    • Exploring potential roles in pathogen-host interactions

  • Emerging technologies:

    • Cryo-EM for structural determination

    • Proximity labeling for substrate identification

    • CRISPR-based genetic approaches for functional genomics

    • Advanced computational modeling of enzyme-substrate interactions

  • Translational potential:

    • Insights from D. discoideum enzyme studies may inform understanding of human ZDHHC enzymes

    • Knowledge of regulatory mechanisms could guide development of modulators for human enzymes

    • Evolutionary conservation analysis may reveal fundamental principles of protein S-acylation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.