Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 4 (DDB_G0274251)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant DDB_G0274251 is commercially available as a lyophilized powder (>90% purity via SDS-PAGE) . Key production details include:

  • Expression Region: 1-358 aa (full-length protein) .

  • Buffer Composition: Tris/PBS-based with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended in sterile water with 50% glycerol for long-term stability .

Functional Annotations

Biological Roles

  • Palmitoyltransferase Activity: Likely mediates S-palmitoylation of target proteins, influencing membrane localization and signaling .

  • Immune Response: Homologs in other species (e.g., human ZDHHC4) regulate innate immunity and protein trafficking to the plasma membrane .

  • Vesicle Trafficking: Indirectly linked to dynamin superfamily proteins in D. discoideum, which govern membrane dynamics and pathogen interactions .

Pathway Involvement
While specific pathways remain uncharacterized for DDB_G0274251, ZDHHC enzymes generally participate in:

  • Protein-membrane anchoring.

  • Signal transduction modulation .

Research Applications

Key Uses

  • Antibody Development: Recombinant antibodies against D. discoideum antigens, including DDB_G0274251, enable precise protein localization and functional studies .

  • Host-Pathogen Studies: D. discoideum DSPs (e.g., dynamin-like proteins) are models for analyzing bacterial infection mechanisms .

  • Structural Studies: The protein’s conserved ZDHHC domain makes it a candidate for elucidating palmitoylation mechanisms .

Experimental Tools

  • Proteomic Analysis: Detected in macropinosome proteomes, suggesting roles in endocytic trafficking .

  • FRET-Based Sensors: Recombinant proteins facilitate dynamic studies of signaling molecules like c-di-GMP in D. discoideum .

Comparative Insights

FeatureD. discoideum DDB_G0274251Human ZDHHC4
Gene LocationChromosome-specific (unmapped)Chromosome 7p22.1
FunctionPutative palmitoylationInnate immunity, membrane trafficking
Research FocusModel for vesicle dynamics Cancer, immune disorders

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0274251; Putative ZDHHC-type palmitoyltransferase 4; Zinc finger DHHC domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0274251
Target Protein Sequence
MSKLNIKGIVKRCDDYGKLVNRYCGPVFVGFATSLITLIAITYFTIIFPATSDFSNLFFI FNFFCDLSISLFLTYGIYFNYIKAIITKPGYPNLNSTLINNINSNINNSNNNKDKDKILI IDNVKWSYCKKCSKAKPPRCHHCSVCDKCVLKMDHHCPWIGGCVGFYNYRYFFLFLSYLW VSVCYVLAHSLPLLFGGYLYSKKYTEIDRLLVIISSIGSFITFVAVGSFGGFHAYLIGSG QTSIENLYPPKKRPNYSLTSIKDNFQIVLGKGDYWFSGLLPINYTPIGNGCDFKLNISNE DNNKNNENNENNENNEIDNHNNNNNNNNNNNNNEKEDNINENDNLISYDTDEYNRHKK
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.