Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 5 (DDB_G0275097)

Shipped with Ice Packs
In Stock

Description

Functional Context

While direct substrate mapping for DDB_G0275097 remains unreported, its classification as a ZDHHC-type palmitoyltransferase implies roles in:

  • Protein Localization: S-palmitoylation of membrane-associated proteins .

  • DNA Repair Pathways: D. discoideum exhibits conserved DNA damage response (DDR) mechanisms, and palmitoylation may regulate DDR protein dynamics .

  • Cellular Signaling: Interaction with sphingolipid metabolism pathways, as observed in related ZDHHC enzymes .

Recent chemical genetic studies on human ZDHHC20 and ZDHHC15 highlight methodologies applicable to DDB_G0275097, such as bumped fatty acid probes (e.g., 18-Ac) paired with engineered ZDHHC mutants to identify substrates . These approaches could resolve its specificity in future studies.

Research Applications

  • Structural Biology: AlphaFold models enable virtual screening for inhibitors or interaction partners .

  • Post-Translational Modification Studies: Recombinant protein serves as a positive control in S-acylation assays .

  • Comparative Genomics: D. discoideum’s genetic tractability allows CRISPR-based functional studies to probe its role in DDR or development .

Limitations and Future Directions

  • Unresolved Substrates: No direct substrates identified; homology to human ZDHHCs suggests candidates (e.g., IFITM3-like proteins) .

  • Pathway Mapping: Current databases lack annotated pathways for DDB_G0275097, necessitating proteomic or interactome studies .

  • Structural Validation: Experimental validation (e.g., crystallography) is needed to refine AlphaFold predictions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0275097; Putative ZDHHC-type palmitoyltransferase 5; Zinc finger DHHC domain-containing protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-751
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0275097
Target Protein Sequence
MIPTQTPPRQQMMNHNHQPQQIQQPQQIQPHQPQQQQPHQFRPLDENAEIPFLQIVTPNQ MIKLPPMFQEQYKQLLNRWSNQCIKKSGLLYTQAVPYNQVLVLLEIAKNGDIQEYRDFIQ VIIESNQNKDGDENEESIQQQQQQQQLTLKSIINLIDLEGNTSIHYAIMRKNKAMVSYLI DCGANLDIQNLEEGHTPLHWACIKADSSFVLQLVENGADIHLTDKRGYNALLHAAQYNEV NSVRYLIEKGLDPVQCKDIQLHTAVHWTSFQGHANMARYFISLGVDPNAQDIQGRTAFHW GCIKGHKQVVSMLCSFEGQDSIDKTIRDNDGKTAYQLAESKEHYEIIDYLDTKLKDDKLF GGNERLYHRFWTVMGVLTVLVPTWILCYVPVIFGLPLLAVGGYFLKNYLHLNYWVPERNN WLLPSILYSSVSIWYLIYLLRIAPLVMAINIFPNLIINATSWYFFYFFIRLTKEDPGTIS KHISKEKSNENFMNALSSGRQIPLICPTCLINRPIRSKHCPSCKGCFARFDHHCVWINKC IGINNQALFITVLFSYVILVISGFIVTWDYFKSDSNAPILSESYIQSFLFYYTNYPFILL FSIYGIGMAIWIGKLAISQVLTILFNKTTYEQIQQIREFESRQGHGHSHGGDQQCNHSHG SGGGDHGHSHGGSSGSGSGSGSGDHGHSHGGQPSLPSSSGGSKKDSDKSFHNQQTNFDMY HRGVVNNVKEFLFDSQKFYFQTENIYADSRV
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a eukaryotic social amoeba that has become an important model organism due to its unique developmental cycle that transitions from a single-cell stage to a multicellular structure. This organism offers several advantages as a research model, particularly for studying fundamental cellular processes that are conserved across eukaryotes.

D. discoideum has a fully sequenced genome, is genetically tractable, and its relatively simple growth requirements make it amenable to high-throughput screening approaches. The organism can be grown in axenic culture, allowing for controlled experimental conditions. Its developmental cycle, which can be easily induced and monitored in laboratory settings, provides a valuable system for studying cellular differentiation and morphogenesis .

In toxicology research, D. discoideum has demonstrated utility as a non-animal alternative model for developmental and reproductive toxicity (DART) testing. Studies have shown significant relationships between D. discoideum and mammalian toxicity values, suggesting that this organism has sufficient biological complexity to serve as a predictive model for mammalian systems .

What are ZDHHC-type palmitoyltransferases and their function?

ZDHHC-type palmitoyltransferases are enzymes that catalyze protein palmitoylation, a reversible post-translational modification involving the addition of a 16-carbon fatty acid (palmitate) to cysteine residues of target proteins. This modification is named after the conserved zinc finger DHHC domain (Asp-His-His-Cys) that characterizes this enzyme family.

Protein palmitoylation serves several critical cellular functions:

  • Regulating protein localization to membranes

  • Influencing protein-protein interactions

  • Modulating protein stability and trafficking

  • Affecting signal transduction pathways

In D. discoideum, ZDHHC-type palmitoyltransferases play important roles in various cellular processes. Research on zDHHC5, a related palmitoyltransferase, has demonstrated that these enzymes function through substrate recruitment mechanisms, where specific protein interactions facilitate the palmitoylation of target substrates . The putative ZDHHC-type palmitoyltransferase 5 (DDB_G0275097) in D. discoideum likely has similar mechanistic functions with its own specific substrate profile.

How is recombinant DDB_G0275097 typically expressed and purified?

Based on protocols established for similar ZDHHC-type palmitoyltransferases from D. discoideum, the following expression and purification approach is recommended for DDB_G0275097:

Expression System:
E. coli is the preferred heterologous expression system for recombinant production of D. discoideum ZDHHC-type palmitoyltransferases. The protein is typically expressed with an N-terminal His-tag (either 6× or 10× His) to facilitate purification .

Expression Protocol:

  • Clone the full-length DDB_G0275097 gene (encoding the complete protein) into a suitable expression vector

  • Transform into an E. coli expression strain (BL21(DE3) or similar)

  • Induce protein expression with IPTG when cultures reach appropriate density

  • Harvest cells and prepare lysates under conditions that maintain protein stability

Purification Process:

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

  • Size exclusion chromatography for further purification if needed

  • Lyophilization of the purified protein for long-term storage

The final product is typically stored as a lyophilized powder and should have a purity of >85-90% as determined by SDS-PAGE .

What are the storage and handling recommendations for recombinant DDB_G0275097?

Proper storage and handling of recombinant DDB_G0275097 is essential for maintaining its structural integrity and enzymatic activity. Based on established protocols for similar D. discoideum palmitoyltransferases, the following guidelines are recommended:

Storage Conditions:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • A 50% final glycerol concentration is generally recommended

Storage Buffer:
Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to provide optimal stability for related ZDHHC-type palmitoyltransferases .

Important Precautions:

  • Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity

  • For proteins intended for enzymatic assays, activity should be verified after reconstitution

How can I establish a functional assay to verify DDB_G0275097 palmitoyltransferase activity?

Establishing a robust assay to measure the palmitoyltransferase activity of DDB_G0275097 is crucial for functional characterization. The following methodological approach is recommended:

Metabolic Labeling Assay:

  • Grow D. discoideum cells expressing tagged potential substrate proteins

  • Label cells with radioactive palmitate ([³H]palmitate or [¹⁴C]palmitate)

  • Immunoprecipitate the substrate proteins

  • Detect incorporated palmitate via fluorography or phosphorimaging

  • Compare palmitoylation in wild-type versus DDB_G0275097 overexpression or knockout conditions

Click Chemistry-Based Assay:

  • Label cells with alkyne-palmitate analogs (e.g., 17-ODYA)

  • Perform cell lysis and immunoprecipitation of substrates

  • Conjugate fluorescent or biotin tags via click chemistry

  • Detect palmitoylation using fluorescence scanning or streptavidin blotting

Acyl-Biotin Exchange (ABE) Assay:

  • Block free thiols with N-ethylmaleimide

  • Cleave thioester bonds with hydroxylamine

  • Label newly exposed thiols with biotin-HPDP

  • Purify biotinylated proteins with streptavidin resin

  • Identify palmitoylated proteins via Western blotting or mass spectrometry

In Vitro Enzymatic Assay:

  • Purify recombinant DDB_G0275097 and potential substrate proteins

  • Prepare palmitoyl-CoA as the acyl donor

  • Perform reaction in appropriate buffer conditions

  • Detect palmitoylation using any of the methods described above

These approaches enable quantitative assessment of DDB_G0275097 activity and can be adapted to identify specific substrates and regulatory mechanisms .

What is known about substrate specificity of DDB_G0275097 compared to other ZDHHC-type palmitoyltransferases?

Understanding the substrate specificity of DDB_G0275097 requires comparative analysis with other ZDHHC-type palmitoyltransferases. While specific data on DDB_G0275097 is limited, insights can be drawn from research on related enzymes:

Substrate Recruitment Mechanisms:
Research on zDHHC5 indicates that substrate specificity is determined by specific protein-protein interactions rather than just recognition of a consensus sequence. For example, zDHHC5 contains a juxtamembrane amphipathic helix that recruits the Na-pump α subunit, facilitating palmitoylation of phospholemman (PLM) .

Predicted Substrate Recognition Elements in DDB_G0275097:
Analysis of the protein sequence suggests the presence of:

  • The canonical DHHC catalytic domain

  • Potential protein-protein interaction domains

  • Transmembrane domains that influence substrate accessibility

Comparative Analysis of D. discoideum ZDHHC Palmitoyltransferases:

ZDHHC EnzymeProtein LengthKey DomainsPotential SubstratesCellular Localization
ZDHHC3 (DDB_G0273477)502 aaDHHC domain, multiple transmembrane domainsNot fully characterizedMembrane-associated
ZDHHC8 (DDB_G0280329)375 aaDHHC domainNot fully characterizedMembrane-associated
ZDHHC5 (DDB_G0275097)Approx. 400-500 aa*DHHC domainPredicted membrane proteinsLikely membrane-associated

*Estimated based on related proteins; exact length may vary

To experimentally determine the substrate specificity of DDB_G0275097, a combination of yeast two-hybrid screening, co-immunoprecipitation studies, and palmitoylation assays with candidate substrates is recommended.

What genetic approaches can be used to study DDB_G0275097 function in D. discoideum?

D. discoideum offers versatile genetic tools for studying gene function. The following approaches are recommended for investigating DDB_G0275097:

Gene Knockout/Disruption:

  • Construct a knockout vector containing homology arms flanking a selection marker

  • Transform D. discoideum cells using electroporation

  • Select transformants with appropriate antibiotics

  • Verify gene disruption by PCR and Southern blotting

  • Phenotypically characterize the knockout strain for growth, development, and specific cellular processes

RNA Interference (RNAi):
D. discoideum possesses endogenous RNAi machinery, including RNA-dependent RNA polymerases like RrpC . This system can be exploited for gene silencing:

  • Design hairpin RNA constructs targeting DDB_G0275097

  • Express the construct using an inducible promoter

  • Monitor silencing efficiency by RT-qPCR

  • Evaluate phenotypic changes under varying degrees of gene silencing

CRISPR-Cas9 Genome Editing:

  • Design guide RNAs targeting DDB_G0275097

  • Construct a Cas9 and gRNA expression vector

  • Introduce repair templates for precise modifications

  • Select and verify edited clones

  • Analyze the effect of specific mutations on protein function

Overexpression and Dominant Negative Approaches:

  • Create constructs for overexpression of wild-type or mutant DDB_G0275097

  • Express the constructs using constitutive or inducible promoters

  • Evaluate the effects on palmitoylation of target substrates

  • Assess changes in cellular processes and developmental phenotypes

These genetic approaches can be combined with biochemical assays and phenotypic characterization to comprehensively understand DDB_G0275097 function.

How does palmitoylation by DDB_G0275097 affect protein localization and function in D. discoideum?

The impact of DDB_G0275097-mediated palmitoylation on protein localization and function can be investigated through several experimental approaches:

Fluorescence Microscopy for Localization Studies:

  • Generate fluorescently tagged substrate proteins

  • Compare localization in wild-type, DDB_G0275097-knockout, and DDB_G0275097-overexpressing cells

  • Identify palmitoylation-dependent changes in protein distribution

  • Use site-directed mutagenesis of putative palmitoylation sites to confirm specificity

Membrane Fractionation Experiments:

  • Separate cellular components through differential centrifugation

  • Analyze the distribution of substrate proteins across fractions

  • Compare membrane association in the presence and absence of DDB_G0275097 activity

  • Use palmitoylation inhibitors to confirm the role of this modification

Functional Analysis of Modified Proteins:

  • Assess protein-protein interactions using co-immunoprecipitation or proximity labeling

  • Measure enzymatic activity of palmitoylated versus non-palmitoylated forms

  • Evaluate protein stability and turnover through pulse-chase experiments

  • Analyze signaling pathway activation downstream of palmitoylated proteins

Research on related palmitoyltransferases suggests that palmitoylation can significantly impact protein function through altered membrane localization. For example, studies on zDHHC5 have shown that palmitoylation of phospholemman (PLM) regulates its interaction with the Na-pump α subunit, affecting sodium pump activity .

How can D. discoideum be used as a model system for studying palmitoylation in development?

D. discoideum offers unique advantages for studying palmitoylation in development due to its well-characterized developmental cycle:

Developmental Stages for Analysis:

  • Aggregation to mound stage: Cell migration and adhesion processes dependent on membrane protein function

  • Mound to slug migration: Cell differentiation and pattern formation

  • Slug migration to culmination: Terminal differentiation and morphogenesis

Experimental Approach:

  • Generate DDB_G0275097 knockout or overexpression strains

  • Monitor development under standard starvation conditions

  • Assess timing and morphology of each developmental stage

  • Identify specific developmental processes affected by altered palmitoylation

Techniques for Developmental Analysis:

  • Time-lapse microscopy to track morphological changes

  • Cell-type specific markers to monitor differentiation

  • Transcriptome analysis at various developmental timepoints

  • Proteomics to identify stage-specific palmitoylated proteins

Developmental Phenotyping Assay:
The high-throughput developmental toxicity assay described for D. discoideum can be adapted to assess the developmental consequences of altered palmitoylation :

  • Plate cells at defined density on nutrient-free agar

  • Monitor and quantify development over 24 hours

  • Score developmental progression using established metrics

  • Compare wild-type and DDB_G0275097-mutant strains

This model system allows researchers to connect molecular changes in palmitoylation to specific developmental outcomes in a controlled setting.

What proteomics approaches are optimal for identifying DDB_G0275097 substrates?

Comprehensive identification of DDB_G0275097 substrates requires specialized proteomics approaches:

Acyl-Biotin Exchange (ABE) Coupled with Mass Spectrometry:

  • Perform ABE protocol on wild-type and DDB_G0275097-knockout cells

  • Digest purified palmitoylated proteins with trypsin

  • Analyze peptides using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Compare palmitoylome profiles to identify DDB_G0275097-dependent modifications

Metabolic Labeling with Palmitate Analogs:

  • Label cells with alkyne-palmitate (17-ODYA)

  • Perform click chemistry to attach biotin or other affinity tags

  • Enrich labeled proteins and analyze by LC-MS/MS

  • Compare enrichment in wild-type versus DDB_G0275097-mutant cells

Quantitative Proteomics Workflow:

StepMethodPurpose
Sample PreparationCell lysis in detergent bufferExtract total proteins while preserving modifications
Palmitoylated Protein EnrichmentABE or click chemistrySelectively isolate palmitoylated proteins
Protein DigestionTrypsin treatmentGenerate peptides suitable for MS analysis
Peptide FractionationSCX, high-pH reverse phaseReduce sample complexity
LC-MS/MS AnalysisOrbitrap or similar high-resolution MSIdentify and quantify peptides
Data AnalysisMaxQuant, Proteome Discoverer, etc.Process raw data and identify proteins
Statistical AnalysisPerseus, R, etc.Compare samples and identify significant changes

Bioinformatic Analysis:

  • Predict potential palmitoylation sites using algorithms like CSS-Palm

  • Analyze identified substrates for common sequence motifs or structural features

  • Perform Gene Ontology analysis to identify enriched cellular processes

  • Network analysis to map functional relationships among substrates

These proteomics approaches enable comprehensive characterization of the DDB_G0275097 substrate landscape, providing insights into its biological function.

How can site-directed mutagenesis be used to understand the catalytic mechanism of DDB_G0275097?

Site-directed mutagenesis is a powerful approach for elucidating the catalytic mechanism of DDB_G0275097:

Critical Residues for Mutagenesis:

  • The DHHC motif (Asp-His-His-Cys) in the catalytic domain

  • Conserved residues in the cysteine-rich domain

  • Putative substrate binding regions

  • Regulatory phosphorylation or other post-translational modification sites

Mutagenesis Protocol:

  • Design primers containing the desired mutations

  • Perform PCR-based site-directed mutagenesis

  • Verify mutations by sequencing

  • Express and purify mutant proteins

  • Compare enzymatic activity with wild-type protein

Functional Classification of Mutations:

Mutation TypeTarget ResiduesExpected EffectExperimental Readout
Catalytic coreDHHC motifAbolish enzymatic activityLoss of palmitoylation in vitro and in vivo
Substrate bindingSurface residuesAltered substrate specificityChanged substrate profile in proteomics
Structural integrityConserved cysteinesProtein misfoldingReduced stability, aggregation
Regulatory sitesPhosphorylation sitesModified regulationAltered activity in response to stimuli

Structural-Functional Analysis:

  • Generate a homology model of DDB_G0275097 based on related ZDHHC structures

  • Map mutations onto the structural model

  • Correlate structural location with functional effects

  • Propose a refined model of the catalytic mechanism

This systematic mutagenesis approach will provide detailed insights into how DDB_G0275097 recognizes and modifies its substrates, potentially revealing unique features compared to other ZDHHC-type palmitoyltransferases.

What are the challenges and solutions in studying membrane-associated enzymes like DDB_G0275097?

Studying membrane-associated enzymes like DDB_G0275097 presents several technical challenges:

Challenge 1: Protein Expression and Purification

  • Problem: Membrane proteins often express poorly and may misfold in heterologous systems

  • Solution:

    • Use specialized E. coli strains (e.g., C41(DE3)) designed for membrane protein expression

    • Express in insect or mammalian cells for proper folding

    • Optimize detergent conditions for solubilization

    • Consider expressing soluble domains separately for partial functional studies

Challenge 2: Maintaining Enzymatic Activity

  • Problem: Detergent solubilization may disrupt native lipid interactions essential for activity

  • Solution:

    • Screen various detergents and lipid additives

    • Reconstitute in nanodiscs or liposomes to mimic native membrane environment

    • Develop assays that function in detergent-solubilized state

Challenge 3: Substrate Accessibility

  • Problem: In vitro conditions may not recapitulate native substrate presentation

  • Solution:

    • Co-express enzyme with substrates

    • Design peptide substrates that mimic the native recognition sequence

    • Use cell-based assays to complement in vitro approaches

Challenge 4: Structural Characterization

  • Problem: Membrane proteins are challenging for structural biology techniques

  • Solution:

    • Use cryo-electron microscopy for full-length protein

    • Obtain X-ray structures of soluble domains

    • Employ hydrogen-deuterium exchange mass spectrometry for dynamics

    • Utilize cross-linking mass spectrometry for interaction mapping

Methodological Workflow for DDB_G0275097 Characterization:

  • Initial Expression Screening:

    • Test multiple constructs (full-length and domains)

    • Evaluate expression in different systems

    • Optimize induction and growth conditions

  • Purification Strategy Development:

    • Screen detergents for effective solubilization

    • Implement two-step purification (affinity + size exclusion)

    • Assess protein quality by dynamic light scattering

  • Activity Assay Optimization:

    • Develop fluorescence-based high-throughput assays

    • Validate with known substrates of related enzymes

    • Establish proper controls for background activity

  • Integrated Structural-Functional Analysis:

    • Combine mutagenesis with activity measurements

    • Correlate with available structural information

    • Build comprehensive mechanistic model

These approaches address the specific challenges associated with studying membrane-associated palmitoyltransferases like DDB_G0275097.

How conserved are ZDHHC-type palmitoyltransferases across species?

ZDHHC-type palmitoyltransferases show significant evolutionary conservation across eukaryotic species, with important implications for D. discoideum research:

Evolutionary Conservation:
The DHHC domain, which contains the catalytic cysteine involved in the palmitoylation reaction, is highly conserved from yeast to humans. This conservation suggests fundamental importance in eukaryotic cell biology.

Comparative Analysis Across Model Organisms:

SpeciesNumber of ZDHHC EnzymesNotable FeaturesRelevance to D. discoideum Research
S. cerevisiae7Akr1, Akr2, Erf2, Pfa3, Pfa4, Pfa5, Swf1Basic functional studies in simple eukaryote
D. discoideum~10 (estimated)Including DDB_G0275097, DDB_G0273477, DDB_G0280329Model for social amoeba palmitoyltransferases
C. elegans15Developmental roles identifiedComparison for developmental functions
D. melanogaster22Neural development functionsInsights into specialized tissues
H. sapiens23Disease associations (neurological, cancer)Medical relevance of findings

Domain Organization Conservation:
The core DHHC domain is typically flanked by varying numbers of transmembrane domains and protein-protein interaction motifs. These auxiliary domains likely confer substrate specificity and regulatory properties.

Functional Conservation vs. Specialization:
While the catalytic mechanism is conserved, substrate specificity shows greater divergence between species. This suggests that:

  • Basic enzymatic function evolved early in eukaryotes

  • Expansion of the enzyme family occurred to accommodate increasingly complex cellular processes

  • Specific enzyme-substrate pairs co-evolved within lineages

Insights from comparative studies can guide research on DDB_G0275097 by highlighting conserved features likely to be functionally significant versus species-specific aspects that may relate to D. discoideum's unique biology.

How can comparative studies between D. discoideum and mammalian systems inform therapeutic applications?

Comparative studies between D. discoideum palmitoyltransferases and their mammalian counterparts offer valuable insights for therapeutic applications:

Translational Research Potential:
D. discoideum serves as a simplified model for understanding fundamental mechanisms of protein palmitoylation that can be applied to mammalian systems. Research indicates significant correlation between D. discoideum and mammalian toxicity values, suggesting conserved response pathways .

Drug Target Identification:

  • Identify substrates of DDB_G0275097 in D. discoideum

  • Determine mammalian homologs of these substrates

  • Assess conservation of palmitoylation sites

  • Evaluate the role of palmitoylation in disease-relevant pathways

Drug Screening Applications:
D. discoideum can be utilized for high-throughput screening of compounds that affect palmitoylation:

  • Develop reporter systems for palmitoylation in D. discoideum

  • Screen compound libraries for modulators of palmitoylation

  • Validate hits in mammalian systems

  • Identify potential therapeutic leads

Comparative Pharmacology:

AspectD. discoideum AdvantageTranslation to Mammalian Systems
Genetic manipulationSimpler, faster genetic modificationsGuide more complex mammalian gene editing
High-throughput screeningLower cost, faster resultsPre-screen before mammalian testing
Developmental toxicityComplete developmental cycle observablePredict potential developmental effects
Mechanistic studiesReduced genetic redundancyIdentify core conserved mechanisms

Therapeutic Applications:
Research on zDHHC5 demonstrates that manipulating substrate recruitment to palmitoyltransferases can selectively alter the palmitoylation status of specific proteins . This principle, potentially applicable to DDB_G0275097 homologs, opens avenues for developing targeted modulators of protein palmitoylation with therapeutic potential.

What are common challenges in expressing and purifying active DDB_G0275097, and how can they be addressed?

Researchers frequently encounter challenges when expressing and purifying membrane proteins like DDB_G0275097. Here are common issues and practical solutions:

Challenge: Low Expression Yields

  • Solution 1: Optimize codon usage for E. coli expression

  • Solution 2: Test different promoter strengths and induction conditions

  • Solution 3: Lower induction temperature (16-20°C) to slow protein production and improve folding

  • Solution 4: Add fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Solution 5: Consider baculovirus expression system for improved yields

Challenge: Protein Aggregation

  • Solution 1: Screen multiple detergents (DDM, LMNG, CHAPS) for solubilization

  • Solution 2: Add stabilizing agents (glycerol, specific lipids) to buffers

  • Solution 3: Incorporate cholesterol hemisuccinate or specific phospholipids

  • Solution 4: Use GFP fusion to monitor folding and aggregation state

  • Solution 5: Optimize purification buffer conditions (pH, salt concentration)

Challenge: Loss of Activity During Purification

  • Solution 1: Minimize time between cell lysis and final purification

  • Solution 2: Add reducing agents (DTT, TCEP) to prevent oxidation of catalytic cysteine

  • Solution 3: Include palmitoyl-CoA or substrate mimetics as stabilizing agents

  • Solution 4: Ensure all buffers are degassed to reduce oxidation

  • Solution 5: Purify at 4°C to reduce proteolytic degradation

Challenge: Heterogeneity in Purified Protein

  • Solution 1: Add additional chromatography steps (ion exchange, size exclusion)

  • Solution 2: Optimize detergent concentration to minimize micelle size

  • Solution 3: Use analytical ultracentrifugation to assess oligomeric state

  • Solution 4: Consider on-column detergent exchange during purification

  • Solution 5: Analyze sample by negative-stain EM for quality control

Optimization Protocol for Recombinant DDB_G0275097:

StepOptimization StrategySuccess Indicators
Vector designInclude TEV cleavage site after tagEfficient tag removal
ExpressionTest BL21(DE3), C41(DE3), Rosetta gamiSDS-PAGE shows target band
InductionCompare IPTG concentrations (0.1-1.0 mM)Optimal expression level
LysisEvaluate sonication vs. French pressComplete cell disruption
SolubilizationScreen detergent panelProtein in supernatant
IMACOptimize imidazole gradientPure protein in elution
Size exclusionAnalyze elution profileMonodisperse peak
Activity testingDevelop fluorescent substrate assayMeasurable enzyme activity

These strategies are based on successful approaches for related membrane proteins and can be adapted specifically for DDB_G0275097 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.