Recombinant Dictyostelium discoideum PXMP2/4 family protein 1 (DDB_G0277335)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant DDB_G0277335

Recombinant Dictyostelium discoideum PXMP2/4 family protein 1 (DDB_G0277335) is a synthetic version of a small, 202-amino-acid protein encoded by the DDB_G0277335 gene. This protein belongs to the PXMP2/4 family, which is implicated in cellular development and chemorepulsive signaling in D. discoideum.

Functional Classification

  • Family: PXMP2/4 family, sharing structural similarity with peroxisomal membrane proteins in mammals (e.g., mouse Pxmp2) .

  • Role:

    • Developmental Regulation: Expressed in prestalk cells during multicellular development, critical for morphogenesis .

    • Chemorepulsion Pathway: Linked to AprA-induced repulsion via G protein-coupled receptors (e.g., GrlH) .

Role in Developmental Biology

DDB_G0277335 is part of a 13-member gene family clustered on D. discoideum chromosome 2. These genes are divided into two groups:

  • Group 1: Includes DDB_G0277335 and six homologs with >87% identity.

  • Group 2: Seven genes with 60–70% identity to Group 1 .

Key Observations:

  • Prestalk Expression: Expressed in prestalk cells during slug migration and spore differentiation .

  • Morphogenetic Impact: Antibodies against Group 2 proteins disrupt multicellular structures, indicating a structural or signaling role .

Involvement in Chemorepulsion

DDB_G0277335 is implicated in the AprA-induced chemorepulsion pathway:

  • Mechanism: Binds to GrlH receptors, triggering downstream signaling via G-proteins (e.g., Gα8), Erk1, and PTEN .

  • Functional Partners: Interacts with proteins like Pik6 (PIP kinase) and CutC (copper transporter) in repulsion signaling .

Pathway ComponentRoleEvidence
GrlHGPCR receptor for AprA
Pik6Phosphatidylinositol kinase
CfrBCell-surface glycoprotein

Comparative Analysis of Expression Systems

D. discoideum proteins like DDB_G0277335 are often expressed in heterologous systems, with trade-offs in yield and post-translational modifications:

SystemAdvantagesLimitationsUse Cases
E. coliHigh yield, low costNo eukaryotic modificationsStructural studies, ELISA antigens
BaculovirusProper folding for complex proteinsRequires insect cell culture expertiseFunctional assays (e.g., channel activity)
Cell-FreeRapid production, no host contaminationLimited to small-scale synthesisHigh-throughput screening

Therapeutic and Biotechnological Potential

  • Peroxisomal Studies: While mammalian Pxmp2 functions as a channel protein , DDB_G0277335 may serve as a model for peroxisomal membrane dynamics in simpler eukaryotes.

  • Chemorepulsion Therapeutics: Insights into AprA signaling could inform strategies to modulate cell dispersal in diseases like cancer .

Challenges in Industrial Production

  • Scalability: Cell-free systems offer rapid synthesis but struggle with large-scale production .

  • Post-Translational Modifications: E. coli lacks glycosylation machinery, limiting therapeutic applications .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please inform us of any specific tag requirements; we will prioritize fulfilling such requests.
Synonyms
DDB_G0277335; PXMP2/4 family protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0277335
Target Protein Sequence
MNFRIFDKIGNSYKKSLQNRPVITKSLTGTVVFFLGDTLAQKIENRGYDPKRTLMMCTVG TFIVVPQIHFWFKFLDKTFTKPGWAGAIPKVVVDQLTFGPYLFVCNMTSVQLFHQGFNFD THQWKDKMKKDFFPVLQKAWMIWPLTNCILFRFVHPDYRILISNLVSVGWNCILSTVSNK SFLKNNNNNNDPSISTMASLNE
Uniprot No.

Target Background

Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the significance of using Dictyostelium discoideum as a model for studying PXMP2/4 family proteins?

Dictyostelium discoideum offers several advantages as a model organism for studying PXMP2/4 family proteins. As a eukaryotic amoeba with a unique developmental cycle, it provides a simplified yet relevant system for investigating protein function in cellular processes. Dictyostelium maintains high biological complexity while allowing for high-throughput screening approaches, making it an efficient model for studying protein functions that may be conserved in mammalian systems . The organism has a fully sequenced genome and well-established genetic manipulation techniques, enabling researchers to create knockout mutants, overexpression strains, and other genetic modifications crucial for functional studies of proteins like PXMP2/4 family protein 1 .

For peroxisomal membrane proteins specifically, Dictyostelium's peroxisomes undergo dynamic changes in response to environmental cues, providing an excellent system to study how these proteins contribute to organelle biogenesis, maintenance, and function . The relatively simple culture conditions and rapid growth cycle further enhance its utility as a research model.

How is the expression of DDB_G0277335 regulated during Dictyostelium's developmental cycle?

Similar to many Dictyostelium genes, the expression of DDB_G0277335 likely changes throughout its developmental cycle. While specific data for this protein isn't provided in the search results, the expression pattern of developmental genes in Dictyostelium typically follows distinctive profiles. For instance, the mucolipin gene (mcln) shows varying expression levels during development, with increases during early differentiation, decreases at around 8 hours, and rapid increases during aggregation at 10 hours .

To determine the expression profile of DDB_G0277335, researchers would typically:

  • Cultivate Dictyostelium cells on appropriate media (water agar plates or filters)

  • Collect samples at 2-hour intervals throughout the 24-hour developmental cycle

  • Extract RNA from cells at these timepoints

  • Perform semi-quantitative RT-PCR or RNA-Seq to assess relative expression levels

  • Compare results with established databases like DictyBase for validation

Researchers should note that expression patterns may vary slightly between different parental strains (AX2 vs. AX4) and development conditions (water agar vs. filters) . The expression pattern would provide important insights into the potential roles of DDB_G0277335 during different developmental stages.

What are the standard methods for recombinant expression of Dictyostelium DDB_G0277335?

For recombinant expression of Dictyostelium DDB_G0277335, researchers typically employ the following methodology:

  • Vector Selection and Construction:

    • Create expression constructs using vectors specifically designed for Dictyostelium

    • Common vectors include those with constitutive promoters (actin15) or inducible systems

    • Include appropriate tags (His, FLAG, GFP) for purification and visualization

  • Transformation Protocol:

    • Use Ca(PO₄)₂/DNA coprecipitation method for introducing plasmids

    • Co-transformation with selection markers (e.g., G418 resistance)

    • Select transformants on bacterial lawns (e.g., Micrococcus luteus) on standard medium agar with appropriate antibiotics

  • Selection and Verification:

    • Isolate colonies and screen for positive transformants

    • Verify expression using Western blotting, RT-PCR, or fluorescence microscopy (for tagged constructs)

    • Create stable cell lines for consistent expression

  • Expression Optimization:

    • Adjust media conditions and temperature for optimal expression

    • For inducible systems, determine appropriate inducer concentrations and timing

The level of recombinant protein expression should be carefully controlled, as both overexpression and knockdown of proteins in Dictyostelium can sometimes produce similar phenotypes, as observed with mucolipin .

How does alteration of DDB_G0277335 expression affect peroxisome biogenesis and function in Dictyostelium?

Alterations in DDB_G0277335 expression likely impact peroxisome biogenesis and function, given its presumed role as a peroxisomal membrane protein. To investigate these effects, researchers would employ the following approaches:

  • Creation of Expression-Modified Strains:

    • Generate knockdown strains using antisense or RNAi approaches

    • Create overexpression strains with constitutive or regulated promoters

    • Develop knockout mutants using homologous recombination or CRISPR-Cas9

  • Peroxisome Visualization and Quantification:

    • Use fluorescent protein fusions to peroxisomal markers (e.g., PTS1-GFP)

    • Employ specific dyes or antibodies against peroxisomal proteins

    • Quantify peroxisome number, size, and morphology using confocal microscopy and image analysis

  • Functional Assays:

    • Measure β-oxidation of fatty acids and other peroxisomal metabolic activities

    • Assess hydrogen peroxide degradation capacity

    • Evaluate growth on media requiring peroxisomal metabolism

Based on studies of other peroxisomal proteins, DDB_G0277335 might influence peroxisome dynamics through effects on either de novo biogenesis or fission pathways. In Hansenula polymorpha, models that genetically separate these processes show distinct phenotypes when different peroxisomal proteins are manipulated . Similar approaches in Dictyostelium could reveal whether DDB_G0277335 participates primarily in one of these pathways.

When analyzing results, researchers should consider that peroxisomes are remarkably dynamic and can change dramatically in abundance, size, shape, and content in response to numerous environmental cues . Therefore, phenotypic analyses should be conducted under various conditions to fully characterize the protein's function.

What are the calcium signaling implications of DDB_G0277335 dysfunction in relation to peroxisomal activities?

Investigating the relationship between DDB_G0277335 dysfunction and calcium signaling requires sophisticated experimental design, particularly considering the established importance of calcium signaling in Dictyostelium cellular processes. While direct evidence linking PXMP2/4 family proteins to calcium signaling is not explicitly stated in the search results, this relationship can be explored through:

  • Calcium Imaging in Mutant Strains:

    • Express calcium indicators (e.g., apoaequorin) in DDB_G0277335 knockdown/overexpression strains

    • Measure global and local calcium responses to various stimuli

    • Compare calcium dynamics in different subcellular compartments, including peroxisomes

  • Peroxisome-Specific Calcium Measurements:

    • Target genetically encoded calcium indicators specifically to peroxisomes

    • Monitor calcium fluctuations in response to peroxisomal substrate addition

    • Determine whether DDB_G0277335 manipulation alters these calcium responses

  • Chemotactic Response Analysis:

    • Assess calcium-dependent chemotactic movement in mutant strains

    • Evaluate the relationship between peroxisomal function and chemotaxis

    • Determine if defects mirror those seen in other calcium signaling mutants

Based on studies of mucolipin in Dictyostelium, alterations in calcium signaling proteins can significantly impact global chemotactic calcium responses in both vegetative and differentiated cells . If DDB_G0277335 influences calcium homeostasis or signaling, similar phenotypes might be observed, potentially linking peroxisomal function to broader cellular calcium dynamics.

How does DDB_G0277335 compare functionally with mammalian PXMP2/4 homologs in disease models?

Comparative functional analysis between Dictyostelium DDB_G0277335 and mammalian PXMP2/4 homologs involves:

  • Sequence and Structural Analysis:

    • Conduct phylogenetic analysis of PXMP2/4 family proteins across species

    • Compare conserved domains and motifs between Dictyostelium and mammalian homologs

    • Predict functional similarities based on structural conservation

  • Complementation Studies:

    • Express mammalian PXMP2/4 homologs in DDB_G0277335 mutant Dictyostelium

    • Assess rescue of phenotypic defects to determine functional conservation

    • Test Dictyostelium protein expression in mammalian cell models of peroxisomal disorders

  • Disease-Relevant Phenotypic Analysis:

    • Identify Dictyostelium phenotypes that parallel symptoms of human peroxisomal disorders

    • Compare cellular pathology between Dictyostelium mutants and patient-derived cells

    • Evaluate responses to therapeutic compounds in both systems

Dictyostelium has proven valuable for modeling human diseases, particularly lysosomal storage disorders. For example, research has established Dictyostelium models for Neuronal Ceroid Lipofuscinosis (NCL) that show phenotypes similar to human disease manifestations . Similar approaches could be applied to investigate whether DDB_G0277335 dysfunction in Dictyostelium mimics aspects of human peroxisomal disorders.

The predictive value of Dictyostelium for mammalian systems has been demonstrated in toxicology studies, where significant relationships between Dictyostelium and mammalian toxicity values have been observed . This suggests that findings regarding DDB_G0277335 function could have relevant implications for understanding mammalian peroxisomal disease mechanisms.

What are the optimal protocols for studying DDB_G0277335 localization and interactions with the peroxisomal membrane?

To effectively study DDB_G0277335 localization and membrane interactions, researchers should employ a multi-faceted approach:

  • Fluorescent Protein Fusion Constructs:

    • Create N- and C-terminal fluorescent protein fusions (GFP, mCherry)

    • Express in wild-type and peroxisome-deficient backgrounds

    • Visualize using confocal or super-resolution microscopy

  • Subcellular Fractionation:

    • Isolate intact peroxisomes using density gradient centrifugation

    • Perform membrane extraction with different detergents to determine strength of membrane association

    • Conduct protease protection assays to establish topology (orientation in membrane)

  • Immunolocalization:

    • Generate specific antibodies against DDB_G0277335

    • Perform immunofluorescence with peroxisomal markers

    • Use immunogold electron microscopy for precise localization

  • Protein-Protein Interaction Studies:

    • Conduct co-immunoprecipitation with tagged protein

    • Perform proximity labeling (BioID, APEX) with DDB_G0277335 as bait

    • Use yeast two-hybrid or split-GFP approaches for specific interaction testing

  • Membrane Topology Analysis:

    • Apply glycosylation mapping or cysteine accessibility techniques

    • Use FRET-based approaches with strategically placed fluorescent tags

    • Create truncation mutants to identify membrane-spanning domains

When analyzing results, it's important to consider that peroxisomes are dynamic organelles that change in response to environmental conditions . Therefore, localization and interaction studies should be performed under various growth conditions to capture the full spectrum of the protein's behavior.

What high-throughput screening methods can be employed to identify compounds affecting DDB_G0277335 function?

High-throughput screening for compounds affecting DDB_G0277335 function can be approached through:

  • Phenotypic Screening Platforms:

    • Develop growth and developmental toxicity assays in Dictyostelium strains with modified DDB_G0277335 expression

    • Use 96 or 384-well formats with automated imaging systems

    • Measure multiple parameters including growth rate, developmental progression, and peroxisome morphology

  • Reporter-Based Screens:

    • Create reporter constructs linking peroxisomal function to fluorescent or luminescent outputs

    • Engineer strains where DDB_G0277335 activity correlates with measurable signals

    • Screen compound libraries for modulators of reporter activity

  • Genetic Interaction Screens:

    • Employ next-generation functional genomic screens similar to those used for lithium and VPA compound characterization

    • Identify genetic modifiers that enhance or suppress DDB_G0277335 mutant phenotypes

    • Conduct chemogenomic profiling to identify compound-gene interactions

  • Peroxisome-Specific Functional Assays:

    • Measure β-oxidation of fatty acids in high-throughput format

    • Assess hydrogen peroxide metabolism using fluorescent probes

    • Quantify peroxisomal import using reporter proteins

When implementing these screens, it's important to include appropriate controls and validation steps. The high-throughput capabilities of Dictyostelium have been demonstrated in developmental toxicity studies, where significant relationships between Dictyostelium and mammalian toxicity have been established . This suggests that compounds identified in Dictyostelium-based screens for DDB_G0277335 modulators could have relevant effects in mammalian systems.

How can CRISPR-Cas9 gene editing be optimized for studying DDB_G0277335 in Dictyostelium?

Optimizing CRISPR-Cas9 gene editing for studying DDB_G0277335 in Dictyostelium requires attention to several key factors:

  • Guide RNA Design and Validation:

    • Select target sites with minimal off-target effects using Dictyostelium-specific prediction tools

    • Design multiple gRNAs targeting different regions of DDB_G0277335

    • Validate gRNA efficiency using in vitro cleavage assays before cellular application

  • Delivery Methods:

    • Optimize electroporation parameters for Dictyostelium

    • Consider temporary expression systems versus stable integration

    • Test various Cas9 expression systems (constitutive vs. inducible)

  • Repair Template Design:

    • Create homology-directed repair templates for precise modifications

    • Include selection markers flanked by loxP sites for subsequent removal

    • Design templates for various modifications (knockout, point mutations, tagged versions)

  • Screening and Validation Protocol:

    • Develop PCR-based screening methods for identifying edited clones

    • Implement restriction fragment length polymorphism (RFLP) analysis for rapid screening

    • Confirm modifications through sequencing and functional assays

  • Phenotypic Analysis Pipeline:

    • Establish standardized assays for peroxisome visualization and quantification

    • Develop protocols for assessing peroxisomal metabolic functions

    • Create workflows for developmental phenotype assessment

While the search results don't specifically mention CRISPR-Cas9 use in Dictyostelium, the technique has been adapted for this organism in recent years. As with other genetic manipulation techniques in Dictyostelium, researchers should be mindful that both knockdown and overexpression of proteins can sometimes produce similar phenotypes, as observed with mucolipin . This underscores the importance of creating clean knockouts and carefully controlled expression systems when studying DDB_G0277335 function.

How should researchers interpret contradictory phenotypes between DDB_G0277335 knockdown and overexpression strains?

When faced with contradictory phenotypes between knockdown and overexpression strains of DDB_G0277335, researchers should consider:

  • Biological Explanations for Paradoxical Results:

    • Protein dosage effects - both too much and too little can disrupt complex formation

    • Compensatory mechanisms activated in response to altered expression

    • Divergent roles of the protein in different cellular contexts or developmental stages

    • Scaffold protein functions where both absence and excess disrupt proper complex assembly

  • Experimental Validation Approaches:

    • Create an expression gradient with multiple strains having different expression levels

    • Implement temporally controlled expression systems to identify stage-specific effects

    • Use complementary techniques (protein depletion, dominant-negative constructs) to confirm results

    • Perform epistasis experiments with known interactors to place the protein in signaling pathways

  • Systematic Analysis Framework:

    • Categorize phenotypes that show similar responses to both manipulations

    • Identify phenotypes that respond differentially

    • Develop hypothesis-based models to explain the divergent phenomena

This phenomenon of similar phenotypes from both knockdown and overexpression has been observed with other Dictyostelium proteins. For instance, both knocking down and overexpressing mucolipin caused an accumulation or increased acidification of Lysosensor Blue stained vesicles in vegetative cells, and both manipulations resulted in smaller slugs and larger numbers of fruiting bodies during multicellular development . This suggests that proper protein levels are crucial for normal function, and disruption in either direction can lead to similar cellular defects.

Expression LevelObserved PhenotypePotential Mechanism
Wild-typeNormal peroxisome functionBalanced protein interactions
KnockdownDefective peroxisome biogenesisInsufficient protein for complex formation
Mild overexpressionEnhanced peroxisome functionOptimal increased capacity
Strong overexpressionDefective peroxisome functionSequestration of interaction partners

What bioinformatic tools are most effective for analyzing the evolutionary conservation and functional domains of PXMP2/4 family proteins?

For comprehensive analysis of PXMP2/4 family proteins across species, researchers should utilize:

  • Sequence Analysis Tools:

    • BLAST and PSI-BLAST for identifying homologs across species

    • MUSCLE, T-Coffee, or MAFFT for multiple sequence alignments

    • HMMER for profile-based searches to detect distant homologs

    • MEGA or PHYLIP for phylogenetic tree construction

  • Structural Prediction Tools:

    • AlphaFold2 or RoseTTAFold for protein structure prediction

    • TMHMM, TOPCONS, or MEMSAT for transmembrane domain prediction

    • SignalP for signal peptide prediction

    • PSIPRED for secondary structure prediction

  • Functional Domain Analysis:

    • InterProScan for comprehensive domain identification

    • Pfam for protein family assignments

    • PROSITE for motif detection

    • ConSurf for evolutionary conservation mapping onto structures

  • Data Integration Platforms:

    • STRING for protein-protein interaction network analysis

    • Cytoscape for network visualization and analysis

    • DictyBase for Dictyostelium-specific information integration

    • UniProt for curated functional annotation comparison

  • Custom Analysis Pipelines:

    • R or Python scripts for automated large-scale sequence analysis

    • Machine learning approaches for functional prediction

    • Covariation analysis to identify co-evolving residues

When analyzing PXMP2/4 family proteins, researchers should focus on conserved features that might indicate functional importance across species. For peroxisomal membrane proteins, special attention should be paid to membrane-spanning domains, targeting signals, and interaction motifs. The dynamic nature of peroxisomes across species suggests that while core functions may be conserved, regulatory mechanisms might vary, requiring careful interpretation of comparative analyses.

How do environmental conditions affect the experimental reproducibility when studying DDB_G0277335 function?

Environmental conditions significantly impact experimental reproducibility when studying DDB_G0277335 function in Dictyostelium. Researchers should consider:

  • Critical Environmental Variables:

    • Media composition (particularly carbon sources that affect peroxisome proliferation)

    • Temperature fluctuations during growth and development

    • Cell density at experiment initiation

    • Bacterial food source (for non-axenic strains)

    • Development surface (water agar vs. filters) for multicellular studies

  • Standardization Protocols:

    • Implement strict media preparation procedures with quality control

    • Maintain consistent temperature control systems

    • Standardize cell harvesting at specific growth phases

    • Establish uniform protocols for developmental induction

  • Experimental Design Considerations:

    • Include wild-type controls in every experiment

    • Process mutant and control strains in parallel

    • Use biological replicates from independent transformants

    • Implement technical replicates to assess method variability

  • Documentation and Reporting Standards:

    • Record all environmental parameters in detail

    • Report complete methodological details in publications

    • Maintain laboratory notebooks with environmental data

    • Consider data repositories for sharing raw data

The importance of environmental conditions is highlighted by observed differences in gene expression patterns between studies. For example, the developmental expression profile of mucolipin showed subtle differences between studies using different parental strains (AX2 vs. AX4) and development conditions (water agar vs. filters) . Similar variations might affect DDB_G0277335 studies, particularly since peroxisomes are highly responsive to environmental changes .

Table: Environmental Factors Affecting DDB_G0277335 Studies

Environmental FactorPotential ImpactStandardization Approach
Carbon sourceAlters peroxisome number and metabolismStrictly define media composition
Cell densityAffects growth rate and gene expressionStandardize starting density in experiments
Development surfaceInfluences developmental timingUse consistent surfaces for developmental studies
TemperatureAffects protein expression and activityMaintain precise temperature control
Bacterial food sourceImpacts metabolic stateUse defined bacterial strains and preparation

What emerging technologies could enhance our understanding of DDB_G0277335's role in peroxisome dynamics?

Several cutting-edge technologies hold promise for advancing our understanding of DDB_G0277335's role in peroxisome dynamics:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy (PALM, STORM, STED) for nanoscale visualization of peroxisome structures

    • Lattice light-sheet microscopy for long-term, low-phototoxicity imaging of peroxisome dynamics

    • Correlative light and electron microscopy (CLEM) for combining functional and ultrastructural information

    • FIB-SEM for 3D reconstruction of peroxisome-organelle contacts

  • Spatiotemporal Protein Control Methods:

    • Optogenetic tools for light-controlled protein activation or inhibition

    • Chemically-induced proximity systems for rapid protein relocalization

    • Auxin-inducible degron (AID) technology for temporal protein depletion

    • Split protein complementation approaches for monitoring real-time interactions

  • Single-Cell and Spatial Omics:

    • Single-cell RNA-seq to capture cell-to-cell variation in response to DDB_G0277335 manipulation

    • Spatial transcriptomics to map expression patterns during multicellular development

    • Proteomics of isolated peroxisomes at different developmental stages

    • Metabolomics approaches to monitor peroxisome-dependent metabolic changes

  • Advanced Genetic Manipulation Techniques:

    • Base editing for precise nucleotide changes without double-strand breaks

    • Prime editing for flexible gene editing with minimal off-target effects

    • CRISPR interference/activation (CRISPRi/a) for temporary gene regulation

    • Large-scale genetic interaction mapping using CRISPR screens

  • Computational and Modeling Approaches:

    • Agent-based modeling of peroxisome biogenesis and dynamics

    • Systems biology approaches to integrate multi-omics data

    • Machine learning for phenotype recognition and classification

    • Mathematical modeling of peroxisome inheritance and proliferation

These technologies could help address key questions about how DDB_G0277335 contributes to peroxisome biogenesis pathways (de novo formation vs. fission) , and how it affects Dictyostelium's unique developmental processes. The combination of these approaches would provide unprecedented insight into the dynamic regulation of peroxisomal proteins during cellular responses to changing environments.

How might DDB_G0277335 research contribute to our understanding of human peroxisomal disorders?

Research on DDB_G0277335 in Dictyostelium has significant potential to advance our understanding of human peroxisomal disorders through several pathways:

  • Comparative Disease Modeling:

    • Establish Dictyostelium phenotypes that parallel human peroxisomal disorder manifestations

    • Create mutations mimicking patient-derived variants in conserved regions

    • Develop high-throughput screening platforms for therapeutic compound identification

    • Validate findings in mammalian systems to confirm translational relevance

  • Fundamental Mechanism Discovery:

    • Uncover novel aspects of peroxisome biogenesis and maintenance applicable across species

    • Identify previously unknown protein-protein interactions relevant to disease

    • Elucidate compensatory mechanisms that could be therapeutically enhanced

    • Map cellular pathways connecting peroxisomal function to broader cell physiology

  • Therapeutic Target Identification:

    • Screen for genetic suppressors of DDB_G0277335 dysfunction

    • Identify genes that when manipulated can rescue peroxisomal defects

    • Discover chemical compounds that restore peroxisome function

    • Determine whether findings translate to mammalian models of peroxisomal disorders

The value of Dictyostelium for modeling human disease has been demonstrated in various contexts. For instance, Dictyostelium has been used to create models of Mucolipidosis type IV, a lysosomal storage disorder, by manipulating the expression of the mucolipin homologue . These models recapitulated aspects of the human disease and provided insights into molecular mechanisms. Similar approaches with DDB_G0277335 could illuminate aspects of peroxisomal biogenesis disorders.

Moreover, studies have shown significant relationships between Dictyostelium and mammalian toxicity values , suggesting that findings in this model organism can have predictive value for human health applications. The simplicity of Dictyostelium combined with its conservation of fundamental cellular processes makes it an excellent system for initial discovery and screening before moving to more complex mammalian models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.