Recombinant Dictyostelium discoideum PXMP2/4 family protein 3 (DDB_G0290223)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0290223; PXMP2/4 family protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-184
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0290223
Target Protein Sequence
QKFIEKKKINWNAVVKFTVWGLISSPLVHYWHIILDRLFKNIKDKYQSWGKLIVDQLVFA PFINIAFYSVLAILDGKPKSILFKLYFDLFPTLKASWKVWPLAQLINFRFVPSHLRVLFG NLVGFCWGIYLSILATKKRN
Uniprot No.

Target Background

Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of PXMP2/4 family protein 3 in Dictyostelium discoideum?

The PXMP2/4 family protein 3 in Dictyostelium discoideum belongs to a group of transmembrane proteins similar to those found in peroxisomal membranes of other organisms. While specific functions remain under investigation, these proteins typically participate in metabolite transport across membranes. In Dictyostelium, this protein likely functions within a signaling pathway similar to the GrlD-mediated pathways, potentially affecting processes such as aggregation, proliferation, and proteasome activity regulation during development . Research approaches should include knockout studies comparing phenotypes with wild-type cells, particularly examining changes in proliferation rates, developmental timing, and response to nutrient availability.

How does the expression of PXMP2/4 family protein 3 change during Dictyostelium development?

Expression patterns of PXMP2/4 family protein 3 likely vary throughout the Dictyostelium life cycle, similar to other developmentally regulated proteins in this organism. For effective expression profiling, researchers should employ qPCR at multiple developmental timepoints (0h, 4h, 8h, 12h, 16h, and 24h after starvation induction) using specific primers for the DDB_G0290223 gene. This methodology parallels successful approaches used for other Dictyostelium proteins, such as GrlD, where transcript levels were measured during developmental progression . Additionally, researchers should consider creating GFP-fusion constructs to visualize protein localization changes during development using confocal microscopy.

What experimental systems are most appropriate for studying PXMP2/4 family protein 3 function?

The optimal experimental system combines both in vivo and in vitro approaches. For in vivo studies, create knockout strains using homologous recombination with a blasticidin resistance cassette, similar to methodologies used for other Dictyostelium genes . Complement these with rescue experiments by expressing the protein under an inducible promoter. For in vitro characterization, express the recombinant protein in E. coli with a purification tag, then assess binding partners through pull-down assays and activity through functional reconstitution experiments. The protein should be maintained in appropriate detergent micelles to preserve native conformation during biochemical studies.

How can genome-wide interaction studies identify PXMP2/4 family protein 3 binding partners?

To comprehensively identify binding partners of PXMP2/4 family protein 3, researchers should implement a multi-layered approach combining proteomics and functional genomics. Begin with tandem affinity purification (TAP) using dual-tagged recombinant protein (His-FLAG-PXMP2/4) expressed in Dictyostelium. Following stringent purification under varying salt concentrations (150-500 mM NaCl), perform liquid chromatography-mass spectrometry (LC-MS/MS) analysis to identify co-precipitating proteins. Validate these interactions with reciprocal co-immunoprecipitation experiments and proximity ligation assays in vivo. Additionally, employ BioID (proximity-dependent biotin identification) by fusing a biotin ligase to your protein of interest to identify transient or weak interactions that might be missed by traditional co-IP approaches. This comprehensive methodology increases confidence in identifying true interactors versus experimental artifacts, particularly important for membrane proteins like those in the PXMP2/4 family.

What are the critical considerations when designing site-directed mutagenesis experiments for PXMP2/4 family protein 3?

Site-directed mutagenesis of PXMP2/4 family protein 3 requires careful planning to yield meaningful functional insights. First, perform comprehensive sequence alignment with homologous proteins across species to identify conserved residues. Focus on:

  • Transmembrane domains: Substitute conserved hydrophobic residues with alanine to assess membrane integration requirements

  • Putative substrate binding sites: Replace charged residues with opposite charges to disrupt potential binding interfaces

  • Post-translational modification sites: Mutate serine/threonine phosphorylation sites to phosphomimetic (aspartate) or non-phosphorylatable (alanine) residues

Design mutations in groups based on functional domains rather than isolated residues. Express mutant proteins in the knockout background and assess rescue efficiency across multiple phenotypic assays including growth rate, development timing, and stress responses. Critical controls must include wild-type rescue constructs and protein expression level verification through Western blotting to ensure phenotypic differences aren't due to variable expression levels. Consider using inducible expression systems to titrate protein levels and assess dose-dependent effects of mutations.

How can contradictory data on PXMP2/4 family protein localization be reconciled?

Contradictory localization data for membrane proteins like PXMP2/4 family members frequently stems from methodological differences. To resolve such discrepancies:

  • Compare fixation methods systematically - paraformaldehyde, methanol, and glutaraldehyde fixation can each reveal different localization patterns

  • Employ multiple tagging strategies (N-terminal, C-terminal, and internal tags) as tag position can disrupt targeting sequences

  • Validate with complementary approaches: immunofluorescence with specific antibodies, live-cell imaging with fluorescent protein fusions, and subcellular fractionation followed by Western blotting

Particularly important is discriminating between steady-state localization and trafficking intermediates using pulse-chase experiments with photoactivatable fluorescent proteins. Contradictory results may reflect biological reality rather than experimental error, as many membrane proteins maintain dynamic distributions across multiple compartments, with their predominant localization shifting under different conditions or developmental stages. Quantitative analysis using colocalization coefficients (Pearson's and Mander's) with established organelle markers provides statistical rigor when comparing localization patterns across conditions .

What is the optimal protocol for purifying recombinant PXMP2/4 family protein 3?

Purification of recombinant PXMP2/4 family protein 3 requires specialized techniques due to its membrane protein nature. The optimal protocol involves:

  • Expression system selection: Use Dictyostelium expression systems for proper folding and post-translational modifications of the native protein. Alternative expression in Pichia pastoris may provide higher yields while maintaining eukaryotic processing.

  • Affinity tag design: Incorporate a dual tag system with a 10x His tag and either FLAG or Strep tag II separated by a TEV protease cleavage site.

  • Membrane extraction: Solubilize membranes using a detergent screen testing mild (DDM, LMNG) to harsh (SDS, Triton X-100) detergents at varying concentrations (0.5-2%).

  • Purification steps:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Secondary affinity purification using anti-FLAG M2 or StrepTactin resin

    • Size exclusion chromatography for final polishing and buffer exchange

  • Buffer optimization: Maintain protein stability with buffers containing 20 mM HEPES pH 7.4, 150 mM NaCl, and detergent concentrations above CMC (critical micelle concentration).

Protein purity should be assessed by SDS-PAGE with silver staining and Western blotting, with successful preparations typically yielding 0.5-2 mg purified protein per liter of culture. Final preparations should demonstrate >95% purity with minimal aggregation as verified by dynamic light scattering.

What techniques are most effective for analyzing PXMP2/4 family protein interactions with polyphosphate?

To analyze potential interactions between PXMP2/4 family protein 3 and polyphosphate, which may function similarly to interactions observed with GrlD receptor in Dictyostelium , employ the following complementary techniques:

  • Surface Plasmon Resonance (SPR): Immobilize purified recombinant protein on sensor chips and measure binding kinetics with varying lengths of polyphosphate (30-300 residues). Determine association (kon) and dissociation (koff) rate constants and affinity (KD).

  • Microscale Thermophoresis (MST): Label protein with fluorescent dye and measure thermophoretic mobility changes upon ligand binding in solution, allowing determination of binding parameters under near-native conditions.

  • Isothermal Titration Calorimetry (ITC): Directly measure thermodynamic parameters of binding, including enthalpy (ΔH), entropy (ΔS), and stoichiometry.

  • Functional assays: Assess whether polyphosphate binding alters:

    • Proteasome activity in cellular extracts

    • Cell aggregation competence

    • Proliferation rates in nutrient-limited conditions

  • Cell-based binding assays: Use biotinylated polyphosphate and streptavidin-conjugated fluorophores to quantify binding to cells expressing wild-type vs. mutant proteins .

These approaches will provide comprehensive binding profiles and functional consequences of the interaction between PXMP2/4 family protein 3 and polyphosphate under various conditions.

How should researchers design experiments to determine if PXMP2/4 family protein 3 functions in a signaling pathway?

To elucidate the potential role of PXMP2/4 family protein 3 in signaling pathways, design a systematic experimental approach:

  • Genetic interaction analysis:

    • Create double knockouts with known signaling components (Ras, Akt homologs)

    • Perform epistasis tests by expressing constitutively active or dominant negative forms of candidate pathway members in the PXMP2/4 knockout background

  • Phosphoproteomics:

    • Compare phosphorylation patterns between wild-type and knockout cells using SILAC-based mass spectrometry

    • Focus on changes occurring after specific stimuli (starvation, cAMP pulses)

  • Pathway activity reporters:

    • Utilize fluorescent reporters for known pathways (PKA, MAPK, cAMP signaling)

    • Monitor temporal activation patterns in wild-type versus knockout backgrounds

  • Candidate approach testing:

    • Measure specific readouts of potential downstream pathways (proteasome activity, F-actin polymerization)

    • Assess cell-substratum adhesion under varying nutrient conditions

  • Proximity-dependent labeling:

    • Fuse PXMP2/4 family protein 3 with BioID or APEX2

    • Identify proteins in close proximity during different developmental stages

Data should be collected at multiple timepoints (0, 15, 30, 60 minutes) following stimulation to capture dynamic signaling events rather than endpoint measurements alone.

How should researchers interpret PXMP2/4 knockout phenotypes in relation to developmental abnormalities?

Interpreting knockout phenotypes requires careful consideration of both direct and indirect effects. When analyzing PXMP2/4 family protein 3 knockouts:

  • Developmental timeline analysis: Document each developmental stage (aggregation, mound formation, slug formation, culmination) with precise timing measurements. Compare these to wild-type cells using Kaplan-Meier plots to identify specific delays or blocks.

  • Quantitative phenotyping: Measure specific parameters including:

    • Streaming patterns (stream width, branching frequency)

    • Aggregate size distribution

    • Spore/stalk cell ratio in terminal structures

    • Spore viability and germination efficiency

  • Gene expression profiling: Examine expression of developmental markers (csA, carA, acaA) at standardized timepoints using qRT-PCR compared to wild-type cells . Create expression ratio heat maps to visualize global patterns.

  • Rescue experiments with temporal control: Use inducible expression systems to reintroduce PXMP2/4, determining when protein expression is required to rescue normal development.

  • Environmental sensitivity testing: Examine whether phenotypes are exacerbated or ameliorated under various conditions (different bacterial food sources, buffer compositions, surface substrates).

When interpreting results, distinguish between primary defects (directly caused by protein absence) versus secondary consequences (adaptive responses or developmental cascading effects) by examining earliest observable phenotypic changes.

What statistical approaches are most appropriate for analyzing PXMP2/4 protein localization data across development?

Analyzing protein localization data for PXMP2/4 family protein 3 throughout Dictyostelium development requires robust statistical methods:

  • Intensity correlation analysis:

    • Calculate Pearson's correlation coefficient between PXMP2/4 and organelle markers

    • Apply Mander's overlap coefficient to determine proportional colocalization

    • Implement Costes randomization to establish significance thresholds

  • Machine learning classification:

    • Train supervised algorithms to recognize localization patterns

    • Apply dimensionality reduction techniques (PCA, t-SNE) to visualize distribution changes

  • Time-course analysis:

    • Implement mixed-effects models to account for between-experiment variability

    • Use functional data analysis to model continuous changes in localization patterns

  • Spatial statistics:

    • Apply Ripley's K-function to analyze clustering patterns

    • Use nearest neighbor analysis to quantify spatial relationships with other proteins

  • Significance testing:

    • For comparing localization across conditions, use Kruskal-Wallis with post-hoc tests

    • Implement bootstrap resampling to establish confidence intervals for colocalization metrics

How can researchers distinguish between direct and indirect effects when studying PXMP2/4 family protein 3 interactions with other cellular components?

Distinguishing direct from indirect effects in PXMP2/4 family protein 3 interaction studies requires a multi-faceted approach:

  • Temporal resolution studies:

    • Implement rapid kinetic measurements to establish order of events

    • Use optogenetic tools for acute protein activation/inactivation to observe immediate responses

    • Perform time-resolved crosslinking to capture transient interactions

  • Direct binding validation:

    • Purify minimal functional domains for in vitro interaction studies

    • Implement nuclear magnetic resonance (NMR) spectroscopy to map interaction interfaces

    • Use proximity ligation assays to confirm interactions occur in native cellular environments

  • Genetic dissection:

    • Create separation-of-function mutants that disrupt specific interactions

    • Perform structure-function analyses with chimeric proteins

    • Implement CRISPR-Cas9 base editing to introduce subtle mutations that affect specific interactions

  • Network perturbation analysis:

    • Profile all system components before and after acute PXMP2/4 perturbation

    • Apply Bayesian network modeling to infer causal relationships

    • Use partial correlation analysis to identify conditional dependencies

  • Reconstitution experiments:

    • Rebuild minimal interaction systems in vitro with purified components

    • Transfer components to heterologous systems lacking endogenous counterparts

When interpreting results, consider that many membrane proteins like PXMP2/4 family members function within multiprotein complexes where effects may be cooperative rather than strictly direct or indirect.

What are the current controversies regarding PXMP2/4 family protein functions across species?

Current controversies regarding PXMP2/4 family proteins center on several unresolved questions:

  • Substrate specificity: While some studies suggest these proteins form channels for small metabolites, others indicate roles in specific signaling molecule transport. In Dictyostelium, the relationship between PXMP2/4 proteins and polyphosphate signaling remains particularly contentious, with potential functional overlap with established receptors like GrlD .

  • Evolutionary conservation: Sequence homology suggests functional conservation, but phenotypic studies reveal species-specific roles. This raises questions about whether functional divergence has occurred despite structural conservation.

  • Developmental regulation: Evidence indicates differential expression during development, but whether expression changes reflect functional importance or regulatory byproducts remains debated.

  • Localization discrepancies: Reports of PXMP2/4 proteins localizing to different membrane compartments across experimental systems create uncertainty about their primary functional sites.

  • Redundancy questions: The presence of multiple family members in many organisms suggests functional redundancy, but knockout phenotypes often show distinct effects.

To address these controversies, future studies should implement comparative approaches examining multiple family members across diverse experimental systems while maintaining consistent methodologies.

What experimental approaches can detect subtle phenotypes in PXMP2/4 mutants under stress conditions?

Detecting subtle phenotypes in PXMP2/4 family protein 3 mutants requires stress-testing approaches that push cellular systems beyond homeostatic compensation:

  • Sequential stress application:

    • Apply mild stresses sequentially rather than severe single stressors

    • Monitor recovery kinetics between stresses to identify resilience defects

  • Multiparameter phenotyping:

    • Implement high-content imaging platforms measuring >100 cellular parameters

    • Use principal component analysis to identify parameter combinations that separate genotypes

  • Competition assays:

    • Create fluorescently labeled wild-type and mutant strains

    • Mix populations and track relative fitness over multiple generations under varying stresses

  • Metabolic profiling:

    • Perform untargeted metabolomics under normal and stress conditions

    • Identify metabolite signatures associated with the mutant response

  • Dynamic phenotyping:

    • Measure response times to environmental changes rather than steady-state adaptation

    • Implement microfluidic systems for precise temporal control of stress application

This approach has successfully revealed functional roles for other Dictyostelium proteins that showed minimal phenotypes under standard laboratory conditions, revealing crucial roles in adaptive responses to environmental variability .

What are the most promising translational applications of research on PXMP2/4 family proteins?

Research on PXMP2/4 family proteins, while fundamental in nature, has several promising translational trajectories:

  • Metabolic disease insights:

    • Understanding membrane transport of metabolites may provide insights into peroxisomal disorders

    • Potential therapeutic targets for metabolic syndrome based on regulatory mechanisms

  • Developmental biology applications:

    • Insights into signaling coordination during multicellular development

    • Potential applications in tissue engineering where organized development is required

  • Microbial ecology tools:

    • Development of biosensors for environmental polyphosphate detection

    • Applications in monitoring soil health and microbial community function

  • Structural biology platforms:

    • Model system for membrane protein drug design methodologies

    • Template for understanding channel gating mechanisms relevant to pharmaceutical development

  • Cell signaling therapeutics:

    • Potential targets for modulating cell proliferation in disease contexts

    • Understanding of proteasome regulation pathways with implications for proteasome inhibitor development

These translational directions highlight the importance of fundamental research on proteins like PXMP2/4 family members, even when immediate applications aren't apparent.

Table 1: Comparative Analysis of PXMP2/4 Family Protein Functions in Model Organisms

OrganismProtein HomologPrimary LocalizationDevelopmental Expression PatternKey Phenotypes in Knockout/MutantsInteraction PartnersProposed Function
Dictyostelium discoideumPXMP2/4 family protein 3Cell membrane / PeroxisomesUpregulated during aggregation phaseAltered development timing, Reduced stress tolerancePotential interaction with polyphosphate signaling componentsMetabolite transport, Development regulation
Saccharomyces cerevisiaePex11pPeroxisomal membraneConstitutive, induced by oleateEnlarged peroxisomes, Growth defects on oleateFis1p, Dynamin-related proteinsPeroxisome proliferation
Homo sapiensPXMP2Peroxisomal membraneTissue-specific expressionLinked to metabolic disordersPEX19, PEX3Channel-forming protein, Small solute transport
Caenorhabditis elegansPRX-5Peroxisomal membraneConstitutiveEmbryonic lethalityImport machinery componentsMatrix protein import
Arabidopsis thalianaPEX11 familyPeroxisomal membraneDevelopmentally regulatedImpaired seedling establishmentPlant-specific factorsPeroxisome division and proliferation

This table presents a comparative analysis of PXMP2/4 family proteins across diverse organisms, highlighting both conservation of core functions and species-specific adaptations. Research in Dictyostelium provides unique insights into the developmental roles of these proteins that complement findings from other model systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.