Recombinant Dictyostelium discoideum PXMP2/4 family protein 4 (DDB_G0290631)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0290631; PXMP2/4 family protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0290631
Target Protein Sequence
MSRLLVGLKLAQSHYLSQLHKYPVATKAVTSGFLYLISDSLVQGIELSRDKDKKYDFKRS MRMAVFGFAVTGPLFHYWFKYLDKHFPKKSYRHAFIKLTIDQVVCSPVFNFLFFSGMGIL EGKSKDDIVEKLKKDWLTTYVSDCVVWPFINFVNFAYISSIHRVTFMNVCNIGWGAFLAK MNSSH
Uniprot No.

Target Background

Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DDB_G0290631 and what is its significance in research?

DDB_G0290631 is a Pxmp2/4 family protein found in Dictyostelium discoideum, consisting of 185 amino acids. It belongs to a family of peroxisomal membrane proteins that are important for peroxisome structure and function. D. discoideum serves as an excellent model organism for studying fundamental cellular processes, including peroxisome biogenesis and protein targeting mechanisms. Current research suggests this protein may be involved in peroxisomal membrane formation or metabolite transport, similar to other Pxmp2/4 family members .

How does DDB_G0290631 relate to peroxisomal membrane protein targeting pathways?

DDB_G0290631, as a Pxmp2/4 family protein, is likely targeted to peroxisomes through pathways involving PEX3, PEX19, and potentially PEX16. In the canonical pathway, peroxisomal membrane proteins (PMPs) like DDB_G0290631 are recognized in the cytosol by PEX19, which functions as both a chaperone and import receptor. The PEX19-PMP complex then docks with PEX3 on the peroxisomal membrane, facilitating membrane insertion. Based on comparative genomics of peroxisomal proteins, these targeting mechanisms are highly conserved across species, though with organism-specific variations .

What is known about the domain structure of DDB_G0290631?

The domain architecture of DDB_G0290631 includes:

  • A signal sequence for targeting to the secretory pathway

  • Transmembrane domains characteristic of peroxisomal membrane proteins

  • Conserved regions common to the Pxmp2/4 protein family

As a full-length 185 amino acid protein, DDB_G0290631 likely contains specific amino acid motifs that direct its localization to peroxisomes. While the protein has been less extensively characterized than other peroxisomal proteins, its membership in the Pxmp2/4 family suggests functional domains involved in metabolite transport or membrane organization .

What expression systems are most suitable for producing recombinant DDB_G0290631?

Expression SystemAdvantagesLimitationsBest Used For
E. coliCost-effective, high yields, rapid growthPotential inclusion body formation, lack of eukaryotic modificationsInitial structural studies, antibody production
Insect cellsBetter membrane protein folding, eukaryotic modificationsHigher cost, longer production timeFunctional studies requiring proper folding
D. discoideumNative environment, authentic modificationsTechnical challenges in transfection and selectionStudies requiring physiological interactions

For most research applications, E. coli remains the system of choice due to its simplicity and cost-effectiveness, provided that protein solubility and folding challenges can be addressed .

How can I optimize expression conditions for recombinant DDB_G0290631 in E. coli?

A multivariant experimental design approach is recommended to systematically optimize expression conditions. Key variables to consider include:

  • Induction parameters: Cell density at induction (OD600), inducer concentration (IPTG), and post-induction temperature

  • Media composition: Yeast extract, tryptone, and carbon source concentrations

  • Expression duration: Typically 4-6 hours for optimal productivity balance

Based on statistical analysis from similar protein expression optimizations, the following conditions often yield high levels of soluble membrane protein expression:

ParameterRecommended RangeEffect on Expression
Induction OD6000.6-0.8Higher cell density at induction significantly increases yield
IPTG concentration0.1-0.5 mMLower concentrations often enhance solubility
Post-induction temperature16-20°CLower temperatures reduce inclusion body formation
Tryptone concentration15-20 g/LHigher tryptone levels enhance expression
Expression time4-6 hoursOptimal balance between yield and degradation

This approach has demonstrated success in achieving yields of up to 250 mg/L for challenging recombinant proteins .

What purification strategies are most effective for His-tagged DDB_G0290631?

A multi-step purification strategy is recommended:

  • Lysis and solubilization:

    • For membrane proteins, include appropriate detergents (DDM, LDAO, or C12E8) in lysis buffers

    • Consider mild sonication or French press for cell disruption to prevent protein aggregation

  • Primary purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Gradient elution with imidazole (20-250 mM)

  • Secondary purification:

    • Size exclusion chromatography to separate functional protein from aggregates

    • Example: Sephadex size separation column with elution monitoring at 70-30 kDa range

  • Quality assessment:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Dynamic light scattering for homogeneity analysis

This approach follows similar protocols that successfully purified proteins from D. discoideum with high purity (>75%) .

How can I determine the subcellular localization of DDB_G0290631 in Dictyostelium cells?

Multiple complementary approaches should be employed:

  • Fluorescent protein fusion analysis:

    • Generate C-terminal or N-terminal GFP fusions (considering the topology of the protein)

    • Express in D. discoideum cells under native or constitutive promoters

    • Visualize using confocal microscopy to assess peroxisomal localization

  • Co-localization studies:

    • Use established peroxisomal markers (e.g., PEX14 or catalase)

    • Perform immunofluorescence with antibodies against both DDB_G0290631 (or its tag) and peroxisomal markers

    • Calculate Pearson's correlation coefficient to quantify co-localization

  • Subcellular fractionation:

    • Isolate peroxisomal fractions from D. discoideum cells

    • Detect DDB_G0290631 by western blotting

    • Compare distribution across cellular fractions using organelle-specific markers

This multi-method approach provides robust evidence for protein localization, as demonstrated in studies of peroxisomal membrane proteins like PEX14 .

What approaches can determine if DDB_G0290631 has bacteriolytic activity?

Given that D. discoideum contains several bacteriolytic proteins (e.g., BadA family), investigating potential bacteriolytic activity of DDB_G0290631 requires:

  • In vitro bacteriolytic assays:

    • Express and purify recombinant DDB_G0290631

    • Test activity against bacterial suspensions (e.g., Klebsiella pneumoniae)

    • Conduct assays at acidic pH (pH ~2) to mimic phagosomal conditions

    • Monitor bacterial lysis through optical density measurements

  • Comparative analysis:

    • Compare activity of wild-type vs. DDB_G0290631-overexpressing cell extracts

    • Test sensitivity of different bacterial strains, including those with modified cell walls

  • Immunodepletion studies:

    • Deplete DDB_G0290631 from cell extracts using specific antibodies

    • Measure changes in bacteriolytic activity post-depletion

These approaches align with methodologies used to characterize bacteriolytic proteins like BadA in D. discoideum .

How can I investigate protein-protein interactions involving DDB_G0290631?

Several complementary techniques are recommended:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged DDB_G0290631 in D. discoideum

    • Perform pull-down assays under native conditions

    • Identify binding partners through mass spectrometry

  • Proximity labeling approaches:

    • Fuse DDB_G0290631 with BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Yeast two-hybrid screening:

    • Use DDB_G0290631 as bait (considering membrane protein limitations)

    • Screen against D. discoideum cDNA library

    • Validate positive interactions through secondary assays

  • Split-GFP complementation assays:

    • Fuse DDB_G0290631 with one GFP fragment

    • Fuse candidate interacting proteins with complementary GFP fragment

    • Monitor fluorescence recovery upon protein interaction

These approaches can reveal interactions with other peroxisomal proteins and help establish functional networks .

How can CRISPR-Cas9 genome editing be applied to study DDB_G0290631 function?

CRISPR-Cas9 genome editing offers powerful approaches to study DDB_G0290631:

  • Gene knockout strategy:

    • Design sgRNAs targeting the DDB_G0290631 coding sequence

    • Introduce frameshift mutations to generate null alleles

    • Confirm knockout by sequencing and western blotting

    • Analyze peroxisome structure and function in knockout cells

  • Endogenous tagging:

    • Design homology-directed repair templates with fluorescent tags

    • Create C-terminal or N-terminal fusions at the endogenous locus

    • Visualize native expression patterns and dynamics

  • Promoter modifications:

    • Introduce inducible promoter elements to control expression

    • Create conditional alleles for studying essential functions

  • Domain-specific mutations:

    • Introduce precise amino acid substitutions to test functional hypotheses

    • Create phosphomimetic or phospho-dead variants to study regulation

This approach has been successfully used to generate PEX3 knockout cell lines for studying peroxisomal membrane protein localization .

What can comparative genomics reveal about DDB_G0290631 evolution and function?

Comparative genomics approaches provide evolutionary context:

  • Phylogenetic analysis:

    • Align DDB_G0290631 with Pxmp2/4 family proteins across species

    • Construct maximum likelihood phylogenetic trees

    • Identify conserved residues and domains

  • Synteny analysis:

    • Compare genomic context of DDB_G0290631 orthologs

    • Identify co-evolved gene clusters

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Locate sites under positive or purifying selection

  • Domain architecture comparison:

    • Analyze domain arrangements across species

    • Identify lineage-specific adaptations

This approach has revealed important insights into peroxisomal protein evolution, showing how core components like PEX genes have been conserved while others have undergone lineage-specific adaptations .

How does DDB_G0290631 compare to the bacteriolytic protein family in Dictyostelium?

DDB_G0290631 belongs to the Pxmp2/4 family, while D. discoideum bacteriolytic proteins like BadA belong to a different family characterized by:

  • Structural comparison:

    • BadA proteins contain a DUF3430 domain with conserved cysteine residues

    • They typically have a signal sequence and Y/FxxxxC motifs

    • Pxmp2/4 proteins like DDB_G0290631 have transmembrane domains

  • Functional differences:

    • BadA proteins exhibit bacteriolytic activity at acidic pH

    • Pxmp2/4 family proteins typically function in metabolite transport

  • Cellular localization:

    • BadA proteins are targeted to phagosomes/lysosomes

    • DDB_G0290631 likely localizes to peroxisomal membranes

Despite these differences, both protein families contribute to D. discoideum's environmental adaptations - BadA proteins to bacterial predation and Pxmp2/4 proteins to metabolic flexibility .

Why does recombinant DDB_G0290631 form inclusion bodies, and how can I improve solubility?

As a membrane protein, DDB_G0290631 often forms inclusion bodies due to hydrophobic regions. Several strategies can enhance solubility:

  • Expression optimization:

    • Reduce temperature to 16°C during induction

    • Lower IPTG concentration to 0.1-0.2 mM

    • Use rich media with osmolytes like glycerol (5-10%)

  • Genetic strategies:

    • Express as fusion with solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider using cell-free expression systems

  • Buffer optimization:

    • Include mild detergents during lysis (0.1% DDM or LDAO)

    • Add stabilizing agents (10% glycerol, 150-300 mM NaCl)

    • Test different pH conditions (pH 7.0-8.0)

Studies on recombinant protein expression show that optimizing these parameters can dramatically improve soluble yields, even for challenging membrane proteins .

What are effective strategies for refolding DDB_G0290631 from inclusion bodies?

If inclusion bodies are unavoidable, refolding can be attempted:

  • Inclusion body isolation:

    • Extract with denaturing buffers (8M urea or 6M guanidine-HCl)

    • Wash extensively to remove impurities

    • Solubilize at high protein concentration (5-10 mg/ml)

  • Refolding methods:

    • Dialysis: Gradually remove denaturant while introducing detergents

    • Dilution: Rapidly dilute into refolding buffer with detergent micelles

    • On-column: Immobilize denatured protein and refold while bound

  • Refolding buffer composition:

    • Mild detergents (0.1% DDM, LDAO, or C12E8)

    • Stabilizing additives (0.5-1M arginine, 10% glycerol)

    • Redox pairs (5:1 GSH:GSSG) for disulfide formation

  • Monitoring refolding:

    • Measure light scattering to detect aggregation

    • Assess secondary structure by circular dichroism

    • Test functional activity against known substrates

This approach has been successfully applied to other membrane proteins and can yield functionally active protein, though often with lower recovery rates than direct soluble expression .

How can I verify that purified recombinant DDB_G0290631 is properly folded and functional?

Multiple complementary approaches should be used:

These methods collectively provide strong evidence for proper folding and function of the recombinant protein and should be performed before using the protein in downstream applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.