Recombinant Dictyostelium discoideum Reactive oxygen species modulator 1 homolog (romo1)

Shipped with Ice Packs
In Stock

Description

General Information

Dictyostelium discoideum is a cellular slime mold that serves as a valuable model organism for studying cell and developmental biology due to its simple life cycle and ease of handling . Recent studies suggest that Dictyostelium, along with other cellular slime molds, could be a source of novel compounds for pharmacological and medical research .

Recombinant Full Length Dictyostelium discoideum Reactive Oxygen Species Modulator 1 Homolog (Romo1) Protein is a protein that was fused to an N-terminal His tag and expressed in E. coli . The protein sequence consists of amino acids 1-128 (Q54M86) . Reactive Oxygen Species Modulator 1 (ROMO1) is a protein involved in the production of ROS by complex III of the mitochondrial electron transport chain . Other names for ROMO1 include hGlyrichin, Epididymis tissue protein Li 175, and Mitochondrial targeting GxxxG motif protein (MTGM2) . In humans, the mitochondrial protein consists of 79 amino acids and is located on chromosome 20q11.22 .

Function and Significance

ROMO1 interferes with the production of reactive oxygen species (ROS); increased levels of this protein can lead to increased oxidative stress, potentially contributing to diseases, especially cancer . Homo sapiens Romo1 has two transmembrane domains (TMDs), each containing an α helix, connected by a basic loop . TMD1 has a hydrophobic α helix, while TMD2 contains polar amino acids (K58, T59, Q62, S63, T66, and T69) separated by other amino acids, with 3.6 amino acids in each α-helical turn . ROMO1 can stimulate cellular proliferation by producing ROS and activating signaling mediators like ERK, TGF-β, and their factors, including Smad2/3, extracellular matrix (ECM) proteins, and Epithelial mesenchymal transition (EMT) factors . ROMO1 influences these signaling pathways . Dickkopf1 (DKK1), a protein that interacts with and inhibits signaling pathways like Wnt/B-catenin, also affects ROMO1 gene expression, inhibiting its gene . Spermine, a polyamine involved in cellular and membrane protection, can also associate with ROMO1 due to its antioxidant effects .

Romo1 in Disease

Romo1 overexpression is associated with a poor response to treatment and short survival in patients treated with EGFR-TKIs .

Table 2. Response Rate According to Romo1 Expression

Low Romo1 (n = 71)High Romo1 (n = 25)p-value
Response rate (CR+PR)60 (84.5)17 (68.0)0.0447
Complete Response (CR)1 (1.4)0 (0)
Partial Response (PR)59 (83.1)17 (68.0)
Stable Disease (SD)9 (12.7)3 (12.0)
Progressive Disease (PD)2 (2.8)5 (20.0)

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
romo1; DDB_G0286181; Reactive oxygen species modulator 1 homolog; ROS modulator 1 homolog; Protein MGR2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
romo1
Target Protein Sequence
MSYPKRYGQENNRVLGDANNQCIQSIKMGFLMGAGVGATFGSCIVLIMFAAKKLPRAILM KTLGSSAMKMGGMFGCFMGIGGALRCEVDETKINKNNKNNNNNNNNIHSFFKNSNTEYDI SKFNKTKF
Uniprot No.

Target Background

Database Links
Protein Families
MGR2 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Romo1 and what are its key functions in Dictyostelium discoideum?

Romo1 (Reactive Oxygen Species Modulator 1) is a highly conserved inner mitochondrial membrane protein that regulates mitochondrial ROS production and functions as a redox sensor. In Dictyostelium discoideum, Romo1 is encoded by gene DDB_G0286181, producing a protein of 128 amino acids .

The Dictyostelium Romo1 homolog shares functional similarities with human Romo1, particularly in:

  • Regulation of mitochondrial respiration and ROS production

  • Involvement in redox sensing

  • Potential role in mitochondrial dynamics

Unlike many other single-cellular model systems, Dictyostelium's genome encodes homologs of human disease genes, making its Romo1 protein valuable for studying fundamental mechanisms of ROS regulation that are conserved across species .

How does Dictyostelium Romo1 differ from human Romo1?

While functionally similar, key differences between Dictyostelium and human Romo1 include:

FeatureDictyostelium Romo1Human Romo1
Protein Length128 amino acids79 amino acids
Chromosome Location-20q11.22
Alternative Names-hGlyrichin, Epididymis tissue protein Li 175, MTGM2
Sequence HomologyContains conserved functional domainsReference sequence
Expression patternDevelopmental regulationTissue-specific expression

The Dictyostelium Romo1 homolog contains the core functional domains necessary for ROS modulation but has additional amino acid sequences, possibly reflecting adaptation to Dictyostelium's unique lifecycle that alternates between unicellular and multicellular stages .

What experimental systems can be used to study Dictyostelium Romo1 function?

Several experimental approaches have proven effective:

  • Genetic manipulation systems:

    • Gene targeting using CRISPR/Cas9 or homologous recombination

    • The Cre-loxP recombination system for marker recycling during multiple gene disruptions

  • Expression systems:

    • E. coli-based recombinant protein expression (for structural and biochemical studies)

    • Dictyostelium expression vectors for studying function in native context

  • Functional assays:

    • Mitochondrial respiration measurements (basal and maximal)

    • ROS detection using fluorescent markers

    • Developmental phenotype analysis during Dictyostelium life cycle

  • Imaging techniques:

    • Confocal microscopy for mitochondrial morphology assessment

    • Electron microscopy for ultrastructural analysis

How can researchers effectively express and purify recombinant Dictyostelium Romo1?

Based on successful expression protocols:

Expression system optimization:

  • E. coli is the preferred expression system, with BL21(DE3) or Rosetta strains showing good yield

  • Expression constructs should include a His-tag for efficient purification

  • Expression at lower temperatures (16-18°C) after IPTG induction improves protein solubility

Purification protocol:

  • Lyse cells in Tris/PBS-based buffer (pH 8.0) with 6% trehalose

  • Purify using nickel affinity chromatography

  • Further purification by size exclusion chromatography if higher purity is needed

  • Store as lyophilized powder or in buffer with 50% glycerol at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles; aliquot for single use

Reconstitution considerations:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Protein concentration should be verified using standard Bradford or BCA assays

What are the challenges in interpreting data from Romo1 knockout vs. knockdown studies?

Researchers should be aware of important experimental limitations that can affect result interpretation:

  • Contradictory phenotypes:

    • Complete knockout of Romo1 in cell lines shows increased ROS production (3-fold increase compared to controls)

    • siRNA-mediated knockdown shows slightly decreased ROS production

    • This suggests secondary effects in long-term knockouts that may not reflect Romo1's direct function

  • Compensatory mechanisms:

    • Long-term knockout cells may develop compensatory pathways

    • Research has shown different effects on mitochondrial complex activities between knockout and knockdown approaches (Complex II affected in knockout but not in knockdown)

  • Methodological considerations:

    • For acute effects, transient knockdown provides more specific phenotypes

    • For developmental phenotypes, stable knockouts may be necessary

    • Genetic compensation may occur in knockout but not in knockdown models

  • Recommended approach:

    • Use both methods when possible

    • Validate with rescue experiments expressing siRNA-resistant Romo1 versions

    • Create time-series experiments to differentiate primary and secondary effects

How does Romo1 function impact mitochondrial respiration in Dictyostelium compared to human systems?

Studies reveal important similarities and differences:

ParameterDictyostelium Romo1Human Romo1
Basal respirationRoco4/Romo1 knockout cells show increased basal respirationSimilar effect observed in human cells
Maximal respirationReduced in cells with PD-mutated Roco4/Romo1Reduced in cells with Romo1 mutations
Spare respiratory capacity (SRC)Romo1 required for SRC maintenanceRomo1 required for SRC maintenance
Complex II/SDH activitySpecific loss of respiratory activity at Complex II/SDHSimilar effect, with specific loss of Complex II activity
ROS productionIncreased ROS levels in Romo1-knockout cellsContradictory reports on ROS levels depending on cell type and methodology

Researchers have identified that Romo1 plays a critical role in maintaining spare respiratory capacity by regulating Complex II/SDH activity in both Dictyostelium and human systems. This suggests a highly conserved fundamental mechanism across evolutionary distance .

How can Dictyostelium Romo1 be used to model human disease mechanisms?

Dictyostelium provides several advantages as a model system for studying Romo1-related disease mechanisms:

  • Parkinson's disease research:

    • Dictyostelium Roco4 protein has been used as a model for human LRRK2 (Parkinson's disease-associated protein)

    • Roco4/Romo1 knockout cells show similar mitochondrial respiration alterations as seen in PD models

    • The G1179S mutation in Roco4 (equivalent to G2019S in human LRRK2) can be studied in Dictyostelium to understand disease mechanisms

  • Cancer biology applications:

    • Overexpression of Romo1 is associated with poor prognosis in several human cancers

    • Dictyostelium allows research on fundamental mechanisms of Romo1-mediated effects on cell proliferation and ROS production

    • The simplified system enables isolation of direct Romo1 functions from complex cancer microenvironments

  • Methodological approach:

    • Create chimeric proteins combining Dictyostelium and human domains to identify functional conservation

    • Use the Dictyostelium developmental cycle to investigate Romo1's role in different cellular states

    • Apply drug screening in Dictyostelium to identify compounds affecting Romo1 function before testing in more complex systems

What are the considerations for measuring Romo1-mediated ROS production in experimental systems?

When designing experiments to measure Romo1's effects on ROS production, researchers should consider:

  • Timing of measurements:

    • Acute vs. chronic effects show different patterns

    • Measure immediately after manipulation and at several timepoints to capture the complete response profile

  • Detection methods:

    • Use multiple ROS detection methods (fluorescent dyes, protein oxidation markers)

    • Control for autofluorescence issues, particularly in Dictyostelium systems

    • Consider specific ROS types (superoxide, hydrogen peroxide, etc.) as they may be differentially affected

  • Experimental controls:

    • Include positive controls (antimycin A, rotenone) to validate detection systems

    • Use antioxidant treatments to confirm specificity of ROS signals

    • When using fluorescent markers, validate with quantitative biochemical assays

  • Interpretation challenges:

    • Conflicting reports exist on how Romo1 expression correlates with ROS generation

    • Some studies show decreased ROS with decreasing Romo1 expression

    • Others report increased ROS upon Romo1 reduction

    • These contradictions may depend on cell type, experimental timing, and specific ROS detection methods

What structural features of Dictyostelium Romo1 contribute to its function?

Recent structural analyses reveal important insights:

  • Transmembrane domains:

    • Dictyostelium Romo1 contains transmembrane domains similar to class II viroporins

    • Forms homo-oligomeric structures in the inner mitochondrial membrane

    • The amphipathic helical transmembrane domain is necessary for pore-forming activity

  • Channel properties:

    • Functions as a nonselective cation channel

    • Shows specific inhibition by Fe²⁺ ions, connecting its channel function to ROS metabolism

    • Structural modeling suggests a rational hexameric structure

  • Functional domains:

    • Contains GxxxG motifs important for oligomerization

    • Includes conserved redox-sensitive residues

    • Has structurally distinct domains for membrane integration and channel function

  • Experimental approach for structural studies:

    • Use structural bioinformatics combined with experimental validation

    • Apply mutagenesis of key residues to test functional importance

    • Consider lipid environment effects when interpreting structural data

How can researchers distinguish between direct and indirect effects of Romo1 manipulation?

Differentiating primary effects from secondary adaptations is crucial:

  • Recommended experimental design:

    • Implement temporal control systems (inducible knockdown/expression)

    • Use acute inhibition methods where available

    • Compare early vs. late timepoints after manipulation

    • Apply rescue experiments with wild-type and mutant versions

  • Specific measurements to distinguish effects:

    • Immediate changes in ROS levels (minutes to hours)

    • Early changes in mitochondrial membrane potential

    • Delayed changes in protein expression patterns

    • Long-term mitochondrial morphology alterations

  • Analysis approach:

    • When studying Complex II and IV activities, use both BN-PAGE and direct enzyme activity measurements

    • For ROS analysis, distinguish between mitochondrial and cytosolic ROS

    • Use genetic complementation to confirm specificity of observed phenotypes

What are the latest methodological advances for studying Dictyostelium Romo1 in oxidative stress responses?

Recent methodological developments include:

  • Microfluidic approaches:

    • Controlled oxygen gradient generated by microfluidic devices with gas channels

    • Enables precise spatial and temporal control of oxygen concentration

    • Allows real-time observation of cellular responses to hypoxic conditions

  • Fluorescent biosensors:

    • Genetically encoded ROS sensors with improved specificity

    • Subcellular targeting to mitochondria or other compartments

    • Ratiometric measurements for quantitative analysis

  • Combined genetic approaches:

    • Study Romo1 in combination with other oxidative stress modulators

    • Flavohemoglobin mutants (fhbA-/fhbB-) provide models for altered NO/ROS handling

    • Catalase-deficient strains show accelerated aerotactic responses, suggesting hydrogen peroxide involvement in oxygen sensing

  • Mathematical modeling:

    • "Go-or-Grow" mean field modeling to confirm aerotactic responses

    • Integration of cell trajectory analysis with oxygen consumption measurements

    • Allows distinction between true aerotaxis and indirect effects of cell viability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.