Recombinant Dictyostelium discoideum Serine palmitoyltransferase 2 (sptB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sptB; DDB_G0291283; Serine palmitoyltransferase 2; Long chain base biosynthesis protein 2; LCB 2; Serine-palmitoyl-CoA transferase 2; SPT 2; SPT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
sptB
Target Protein Sequence
MEDKEDVENVDDVGYLPILFLYIAYAFIIFNGKLAEFIGKLKGERYLHTPEGYAPLFVEF EYFYQRRMYGRIKDAWDRPINSIAGAWIDVMPRASKHYSQRLELTGGKTIKCLNLGSYNY LGFAQNEGPVADKVIDSIYKYGVYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMG FATNSGTLPALIGKGGLIISDSLNHASLATGCKNTGCKVKVFRHNDSKHLEEVIRESIIQ GQPRTHRPWTMILIIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIGALGKTGRG IVDYYGIDPKEIDILMGTYTKSFGAIGGYVASDKSLIDHLRQSSFSQVYANSMSPVCAVQ ALEALRVIMGEDGTDTGAKKLKQLHDNSNYFREKIREMGFVILGNKDSPVIPLMLFNPAK LSAFSRLCLEKHIAVVVVGYPATPLTEPRTRFCISASHTIEDLDWALRQIDEIGDLITLK FHKGKYLKSK
Uniprot No.

Target Background

Function

The catalytic subunit of serine palmitoyltransferase (SPT) catalyzes the rate-limiting step in sphingolipid biosynthesis: the condensation of serine and palmitoyl-CoA to form the long-chain base 3-ketosphinganine.

Database Links
Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Serine palmitoyltransferase 2 (sptB) in D. discoideum?

Serine palmitoyltransferase 2 (sptB) in D. discoideum is a key enzyme in sphingolipid biosynthesis that catalyzes the condensation of serine with palmitoyl-CoA to form 3-ketodihydrosphingosine (3KDS), the first and rate-limiting step in this pathway. The enzyme shares significant homology with human SPTLC2, containing conserved catalytic domains including a pyridoxal phosphate binding site essential for activity .

D. discoideum sptB, like its human counterpart, likely forms a heterodimeric complex that constitutes the catalytic core of serine palmitoyltransferase. The protein functions primarily in the endoplasmic reticulum membrane, consistent with its role in sphingolipid biosynthesis .

Structurally, D. discoideum sptB contains the characteristic domains found in the LCB2/SPTLC2 family, including the serine palmitoyltransferase domain. For detailed structural analysis, homology modeling based on known SPTLC2 structures can provide insights into the catalytic mechanism and substrate binding sites of D. discoideum sptB.

How does the sphingolipid biosynthesis pathway in D. discoideum compare to humans and other model organisms?

D. discoideum produces phosphoinositol-containing sphingolipids with predominantly phytoceramide backbones, representing a unique sphingolipid profile that differs from mammals . While the pathway of sphingolipid biosynthesis has been well characterized in plants, animals, and fungi, the complete pathway in D. discoideum is still being elucidated.

The first step catalyzed by sptB is conserved across species, but downstream modifications result in organism-specific sphingolipid profiles:

OrganismFirst StepDownstream ProductsUnique Features
D. discoideumsptB catalyzes serine + palmitoyl-CoA → 3KDSPhosphoinositol-containing sphingolipids, phytoceramide backbonesInositol-phosphorylceramide synthase (DdIPCS1) transfers phosphoinositol from PI to ceramide
HumansSPTLC1-SPTLC2 complex catalyzes serine + palmitoyl-CoA → 3KDSSphingomyelin, complex glycosphingolipidsSphingomyelin synthase transfers phosphocholine from PC to ceramide
YeastSimilar SPT complexInositol-phosphorylceramide (IPC)IPC synthases non-homologous to mammalian SM synthases

D. discoideum, positioned evolutionarily at the crossroads between uni- and multicellular life, offers unique insights into the evolution of sphingolipid metabolism .

What are the experimental challenges in characterizing D. discoideum sptB enzymatic activity?

Characterizing D. discoideum sptB enzymatic activity presents several methodological challenges:

  • Production of toxic intermediates: The enzyme produces 3-ketodihydrosphingosine (3KDS), a toxic intermediate that requires efficient detoxification through 3-ketodihydrosphingosine reductase (KDSR) . Researchers must implement strategies to manage this toxicity during enzymatic assays.

  • Membrane protein isolation: As an integral membrane protein localized to the endoplasmic reticulum, sptB requires careful solubilization and purification approaches to maintain structural integrity and activity .

  • Complex formation requirements: Like human SPTLC2, D. discoideum sptB likely requires association with binding partners for optimal activity. Researchers must determine whether the protein functions independently or requires complex formation with other proteins .

  • Assay development considerations: Direct measurement of 3KDS production can be technically challenging. Alternative approaches include coupling the reaction to KDSR activity and measuring NADPH consumption, or using chromatographic methods (HPLC/LC-MS) to detect and quantify reaction products .

  • Substrate specificity determination: The enzyme may exhibit preferences for specific acyl-CoA chain lengths. Comprehensive substrate profiling requires testing multiple acyl-CoA variants under controlled conditions .

A methodological approach to overcome these challenges involves using recombinant expression systems, optimized detergent solubilization, and sensitive analytical techniques like mass spectrometry for product characterization .

What expression systems provide optimal yields of active recombinant D. discoideum sptB?

Multiple expression systems can be employed for recombinant D. discoideum sptB production, each with distinct advantages for specific research applications:

Expression SystemAdvantagesDisadvantagesRecommended Applications
YeastEukaryotic post-translational modifications, membrane protein machinery, endogenous sphingolipid pathwayLower yields than bacterial systems, longer cultivation timeFunctional studies requiring proper folding and post-translational modifications
E. coliHigh yield, rapid expression, cost-effective, in vivo biotinylation capabilityMay lack proper folding for membrane proteins, no post-translational modificationsStructural studies, antibody production, interaction studies with biotinylated protein
BaculovirusEukaryotic processing, high expression levels for membrane proteinsMore complex and expensive than bacterial systemsLarge-scale production of properly folded protein for functional studies
Mammalian cellMost sophisticated eukaryotic protein processingHighest cost, typically lower yieldsStudies requiring mammalian-specific modifications or cofactors

For D. discoideum sptB specifically, yeast expression systems may provide advantages due to the conservation of sphingolipid biosynthesis machinery between D. discoideum and yeast, potentially aiding proper folding and complex formation. Coexpression with binding partners may be necessary for optimal activity regardless of the chosen system.

For successful expression, researchers should consider:

  • Use of codon-optimized sequences for the chosen expression host

  • Inclusion of appropriate fusion tags to facilitate purification

  • Optimization of induction conditions (temperature, duration, inducer concentration)

  • Co-expression of molecular chaperones for improved folding

What purification strategies yield the highest purity and activity for recombinant sptB?

Purification of recombinant D. discoideum sptB requires specialized strategies for membrane proteins while maintaining enzymatic activity. Based on established protocols for similar enzymes, the following multistep approach is recommended:

  • Membrane Isolation and Solubilization:

    • Carefully isolate membrane fractions following cell lysis

    • Solubilize membranes using mild detergents (DDM, CHAPS, or digitonin)

    • Optimize detergent concentration to prevent protein aggregation while maintaining native structure

  • Affinity Chromatography:

    • Utilize fusion tags (His, GST, or biotin) for initial capture

    • For biotinylated protein, streptavidin affinity chromatography provides high specificity

    • Include detergent and stabilizing agents in all buffers

  • Size Exclusion Chromatography:

    • Separate properly folded protein from aggregates

    • Assess complex formation and oligomeric state

    • Monitor protein quality by dynamic light scattering

  • Ion Exchange Chromatography:

    • Provide additional purification based on protein charge properties

    • Remove contaminants with similar size but different charge characteristics

Current commercial preparations achieve >85% purity (SDS-PAGE), indicating that achieving higher purity while maintaining activity remains challenging. Researchers should validate enzyme activity at each purification step, as higher purity doesn't always correlate with higher specific activity for membrane proteins.

For long-term storage, addition of glycerol (20-25%), careful aliquoting, and snap freezing in liquid nitrogen can help preserve enzyme activity. Consider lipid supplementation to maintain the native-like membrane environment.

How can the enzymatic activity of purified D. discoideum sptB be accurately measured and standardized?

Accurate measurement of D. discoideum sptB enzymatic activity requires sensitive and specific analytical approaches. A comprehensive methodology includes:

1. Direct Activity Assays:

  • Radiometric assay: Using [14C]serine or [14C]palmitoyl-CoA to measure radiolabeled 3KDS formation

  • LC-MS/MS analysis: Directly quantifying 3KDS production with high sensitivity and specificity

  • Spectrophotometric coupled assay: Monitoring NADPH consumption when coupling with KDSR activity

2. Standardization Parameters:

  • Include internal standards for absolute quantification

  • Establish enzyme concentration response curves

  • Determine time-dependent activity within linear range

  • Characterize temperature and pH optima

  • Validate substrate saturation conditions

3. Quality Control Metrics:

  • Specific activity (product formed per minute per mg protein)

  • Substrate affinity (Km for serine and palmitoyl-CoA)

  • Inhibitor sensitivity (IC50 for myriocin or other SPT inhibitors)

  • Thermal stability profile

When measuring sptB activity, it's crucial to account for the toxicity of the 3KDS intermediate . Researchers should either include KDSR in the reaction system to convert 3KDS to dihydrosphingosine or limit reaction times to prevent product inhibition.

For comparative studies, activities should be normalized to protein concentration determined by quantitative methods such as amino acid analysis or specific absorption at 280 nm with validated extinction coefficients.

How can genetic manipulation of sptB in D. discoideum provide insights into sphingolipid metabolism?

Genetic manipulation of sptB in D. discoideum offers powerful approaches to investigate sphingolipid metabolism. Building on methodologies used for other D. discoideum genes, researchers can implement the following strategies:

1. Gene Disruption/Knockout Approaches:

  • Homologous recombination to generate sptB-null mutants

  • CRISPR-Cas9 system for targeted gene editing

  • Analysis of growth, development, and stress responses in knockout strains

Similar approaches were successfully used for studying sphingosine kinase (sgkA and sgkB) genes in D. discoideum, where knockout mutants revealed roles in cisplatin sensitivity .

2. Conditional Expression Systems:

  • Inducible promoters to control sptB expression levels

  • Temperature-sensitive mutants to modulate enzyme activity

  • Analysis of phenotypic changes during enzyme activation/inactivation

3. Structure-Function Analysis:

  • Site-directed mutagenesis of catalytic residues

  • Domain swapping with homologs from other species

  • Analysis of how specific protein regions contribute to substrate specificity and catalysis

4. Reporter Systems:

  • Fluorescent protein fusions to monitor sptB localization

  • Promoter-reporter constructs to study transcriptional regulation

  • Biosensors to monitor sphingolipid dynamics in vivo

5. Overexpression Studies:

  • Analysis of phenotypic effects from increased sptB activity

  • Investigation of potential feedback regulation mechanisms

  • Assessment of changes in sphingolipid profiles

Through these approaches, researchers can address key questions about sphingolipid metabolism, including regulation of the pathway, cellular responses to altered sphingolipid levels, and the role of specific sphingolipid species in D. discoideum biology .

What role does sptB play in D. discoideum development and cellular stress responses?

D. discoideum undergoes a complex developmental cycle transitioning from unicellular amoebae to multicellular structures, providing an excellent model for studying developmental processes . The role of sptB and sphingolipid metabolism in these processes can be investigated through several methodological approaches:

Developmental Regulation:

  • D. discoideum development involves distinct stages (aggregation, mound formation, slug migration, culmination)

  • Changes in sphingolipid composition likely occur during these transitions to support changing membrane requirements

  • Time-course analysis of sptB expression and enzyme activity during development can reveal stage-specific regulation

Stress Response Involvement:

  • D. discoideum exhibits remarkable resistance to protein aggregation despite having the highest content of prion-like proteins of all organisms investigated

  • Sphingolipids may contribute to this resistance by maintaining membrane integrity during stress

  • The relationship between sphingolipid composition and stress response can be examined by exposing sptB mutants to various stressors

When examining developmental phenotypes, researchers should implement:

  • Plaque formation assays to assess growth and development on bacterial lawns

  • Development on non-nutrient agar to monitor multicellular morphogenesis

  • Cell-type specific marker analysis to evaluate differentiation patterns

  • Time-lapse microscopy to capture developmental transitions

For stress response studies, researchers should consider:

  • Heat stress resistance assays (relevant for sphingolipid regulation of membrane fluidity)

  • Oxidative stress challenges to assess cellular protection mechanisms

  • Measurement of protein aggregation under various stress conditions

  • Analysis of sphingolipid profiles before and after stress exposure

D. discoideum's established role as a model for neurological disorders suggests that understanding sptB function could provide broader insights into sphingolipid-related diseases.

How does D. discoideum sptB compare to human SPTLC2, and what are the implications for disease modeling?

Comparing D. discoideum sptB to human SPTLC2 reveals important similarities and differences with significant implications for using D. discoideum as a disease model:

Structural and Functional Comparisons:

FeatureD. discoideum sptBHuman SPTLC2Implications for Research
Catalytic mechanismPyridoxal phosphate-dependentPyridoxal phosphate-dependentConserved enzymatic mechanism allows testing of inhibitors across species
Complex formationLikely forms heterodimeric complexForms heterodimeric complex with SPTLC1May require co-expression of binding partners for functional studies
Subcellular localizationEndoplasmic reticulum membraneEndoplasmic reticulum membraneSimilar membrane environment for enzyme function
RegulationUnknown, likely developmentalRegulated by ORMDL proteins, ceramide levelsDifferent regulatory mechanisms may limit direct comparisons
Disease relevanceNo known diseasesMutations cause Hereditary Sensory Neuropathy Type 1 (HSAN1)Can model disease mutations in simplified system

Methodological Approaches for Disease Modeling:

  • Introduction of disease-associated mutations:

    • Engineer D. discoideum sptB to carry mutations equivalent to those causing HSAN1 in humans

    • Analyze effects on enzyme activity, sphingolipid profiles, and cellular phenotypes

  • Functional complementation:

    • Express human SPTLC2 in D. discoideum sptB mutants to assess functional conservation

    • Test whether human disease variants can rescue mutant phenotypes

  • Drug screening applications:

    • Utilize D. discoideum as a simplified system for high-throughput screening of SPT modulators

    • Validate hits in mammalian models

The high-throughput D. discoideum growth and developmental toxicity assays described in the literature can be adapted to evaluate compounds targeting sphingolipid metabolism, potentially accelerating drug discovery for sphingolipid-related disorders.

What is the relationship between sphingolipid metabolism and resistance to protein aggregation in D. discoideum?

D. discoideum possesses the highest content of prion-like proteins among all organisms studied to date, yet remarkably, these aggregation-prone proteins remain soluble in normal conditions . This unique property makes D. discoideum an excellent model for investigating protein homeostasis mechanisms. The potential role of sphingolipid metabolism in this phenomenon can be explored through several experimental approaches:

1. Sphingolipid Composition and Membrane Properties:

  • Sphingolipids influence membrane fluidity, thickness, and microdomain organization

  • These properties may affect protein folding, trafficking, and quality control mechanisms

  • Lipidomic analysis of D. discoideum membranes can reveal unique sphingolipid features that might contribute to protein homeostasis

2. Experimental Approaches:

  • Manipulate sptB expression/activity and analyze effects on protein aggregation

  • Express model aggregation-prone proteins (polyQ, polyN) in wild-type and sptB-modified D. discoideum

  • Analyze stress-induced protein aggregation in cells with altered sphingolipid profiles

  • Investigate membrane properties and protein quality control machinery localization

3. Stress Conditions and Aggregation:
When D. discoideum is exposed to conditions that compromise proteostasis (heat stress, proteasome inhibition), prion-like proteins form cytotoxic aggregates . This transition provides a controlled experimental system to study:

  • Changes in sphingolipid composition during stress

  • Correlation between sphingolipid alterations and protein aggregation

  • Potential protective roles of specific sphingolipid species

4. Molecular Chaperone Interactions:
Molecular chaperones play a prominent role in preventing protein aggregation in D. discoideum . Research can investigate:

  • How sphingolipid composition affects chaperone activity and localization

  • Whether sphingolipid-rich membrane domains serve as platforms for chaperone-mediated protein quality control

Understanding this relationship could provide insights into neurodegenerative diseases characterized by protein aggregation and potentially identify new therapeutic strategies targeting sphingolipid metabolism.

How can D. discoideum sptB be used for drug discovery and development targeting sphingolipid metabolism?

D. discoideum provides a powerful platform for drug discovery targeting sphingolipid metabolism with several methodological advantages:

1. High-Throughput Screening Capabilities:

  • D. discoideum growth and developmental assays have been validated for toxicity evaluation

  • These assays can be adapted to screen compounds targeting sptB activity

  • The unicellular growth phase allows for rapid assessment of compound effects

2. Compound Screening Workflow:

  • Primary growth inhibition screen in liquid culture

  • Secondary developmental assays to assess stage-specific effects

  • Tertiary biochemical assays to confirm target engagement

  • Lipidomic analysis to verify effects on sphingolipid profiles

3. Target Validation Approaches:

  • Generation of resistant mutants to confirm mechanism of action

  • Overexpression of sptB to identify competitive inhibitors

  • Structure-activity relationship studies using mutated enzyme variants

4. Advantages Over Mammalian Systems:

  • Simplified genome (haploid) facilitates genetic manipulation

  • Reduced genetic redundancy compared to mammalian systems

  • Lower cost and ethical considerations compared to mammalian models

  • Established as a valid model for neurological disorders

5. Translation to Human Health:

  • Compounds identified can be progressed to testing in disease-specific models

  • Potential applications in sphingolipid-related disorders, including:

    • Hereditary sensory neuropathies

    • Neurological disorders with aberrant sphingolipid metabolism

    • Cancer, where sphingolipid biosynthesis is often dysregulated

This approach has been validated for other targets in D. discoideum, such as presenilin proteins, where the model system helped characterize the γ-secretase complex relevant to Alzheimer's disease .

What are the most promising techniques for sphingolipidomic analysis in D. discoideum sptB research?

Advanced sphingolipidomic analysis is essential for comprehensive characterization of sphingolipid metabolism in D. discoideum. Current state-of-the-art methodologies include:

1. Mass Spectrometry-Based Approaches:

  • Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS): Provides sensitive detection and quantification of sphingolipid species

  • Shotgun Lipidomics: Enables global profiling of the sphingolipidome with high throughput

  • Multiple Reaction Monitoring (MRM): Allows targeted quantification of specific sphingolipid species

2. Sample Preparation Considerations:

  • Efficient lipid extraction protocols optimized for D. discoideum cells

  • Separation of complex sphingolipids from glycerophospholipids

  • Internal standards for accurate quantification

  • Preservation of labile modifications during extraction

3. Data Analysis Workflows:

  • Automated peak detection and integration

  • Structural annotation of sphingolipid species

  • Statistical analysis to identify significant changes

  • Pathway mapping to correlate changes with cellular functions

4. Complementary Techniques:

  • Imaging Mass Spectrometry: Provides spatial distribution of sphingolipids in multicellular structures

  • Fluorescently Labeled Sphingolipid Precursors: Allows tracking of sphingolipid metabolism in living cells

  • Sphingolipid-Specific Antibodies: Enables visualization of specific sphingolipid species by microscopy

5. Integrated Proteomic Analysis:

  • Combine sphingolipidomic data with proteomic analysis

  • Correlate changes in sphingolipid levels with alterations in protein expression

  • Identify regulatory networks connecting sphingolipid metabolism to cellular functions

This comprehensive analytical approach enables researchers to:

  • Profile the unique sphingolipid composition of D. discoideum, particularly the phosphoinositol-containing sphingolipids with phytoceramide backbones

  • Track changes in sphingolipid profiles during development and stress responses

  • Assess the impact of genetic or pharmacological manipulation of sptB on the sphingolipidome

What evolutionary insights can be gained from studying D. discoideum sptB in relation to sphingolipid metabolism across species?

D. discoideum occupies a unique evolutionary position "at the crossroads between uni- and multicellular life" , making it valuable for comparative studies of sphingolipid metabolism. Several approaches can reveal evolutionary insights:

1. Phylogenetic Analysis:

  • Compare sptB sequences across diverse organisms (amoebae, fungi, plants, animals)

  • Identify conserved catalytic domains and species-specific adaptations

  • Reconstruct the evolutionary history of the SPT enzyme family

2. Functional Conservation Testing:

  • Express sptB homologs from different species in D. discoideum sptB mutants

  • Assess complementation of D. discoideum phenotypes by heterologous enzymes

  • Identify functionally conserved regions through chimeric protein expression

3. Substrate Specificity Evolution:

  • Compare substrate preferences of sptB enzymes across species

  • Identify molecular determinants of substrate specificity changes

  • Correlate specificity with sphingolipid profiles and ecological niches

4. Co-evolution with Interacting Partners:

  • Analyze the evolution of sptB in concert with binding partners

  • Identify co-evolved regulatory mechanisms

  • Compare complex formation requirements across species

5. Adaptation to Environmental Challenges:

  • Investigate how sptB function relates to environmental adaptation

  • Examine correlation between sphingolipid composition and habitat

  • Study species-specific regulation of sphingolipid synthesis under stress

Research has already revealed that D. discoideum produces unique phosphoinositol-containing sphingolipids with predominantly phytoceramide backbones , demonstrating distinct evolutionary adaptations. The identification of an inositol-phosphorylceramide (IPC) synthase in D. discoideum that shares sequence motifs with both yeast IPC and human sphingomyelin synthases provides evidence of evolutionary connections between fungal and animal sphingolipid biosynthesis pathways.

This evolutionary perspective can provide insights into the fundamental roles of sphingolipids in eukaryotic biology and reveal how these pathways have been adapted for specialized functions across different lineages.

How can proteomic approaches enhance our understanding of D. discoideum sptB function and regulation?

Proteomic approaches offer powerful tools for investigating sptB function and regulation in D. discoideum, building upon established mass spectrometry-based proteomic analysis methods for this organism . A comprehensive proteomic strategy would include:

1. Interactome Mapping:

  • Affinity Purification-Mass Spectrometry (AP-MS): Identify proteins that interact with sptB

  • Proximity Labeling: Use BioID or APEX2 fused to sptB to identify proximal proteins in the native cellular environment

  • Cross-linking Mass Spectrometry: Capture transient interactions and determine interaction interfaces

2. Post-translational Modification Profiling:

  • Phosphoproteomics: Identify regulatory phosphorylation sites on sptB

  • Ubiquitylation Analysis: Determine if ubiquitin-mediated regulation occurs

  • Glycosylation Mapping: Assess potential glycosylation modifications

3. Quantitative Proteomics:

  • SILAC or TMT Labeling: Compare proteome changes in wild-type vs. sptB mutants

  • Label-free Quantification: Monitor protein abundance changes during development or stress

  • Targeted Proteomics: Precisely quantify sphingolipid metabolism enzymes using selected reaction monitoring

4. Spatial Proteomics:

  • Subcellular Fractionation: Determine the precise subcellular localization of sptB

  • Organelle Proteomics: Characterize the protein composition of sptB-containing membranes

  • Proximity-dependent Biotinylation: Map the spatial organization of sphingolipid synthesis machinery

5. Functional Proteomics:

  • Activity-based Protein Profiling: Assess sptB activity state in different conditions

  • Thermal Proteome Profiling: Identify proteins stabilized by interaction with sphingolipids

  • Drug Affinity Responsive Target Stability (DARTS): Identify proteins affected by sphingolipid pathway inhibitors

6. Integrative Analysis:

  • Correlate proteomic data with sphingolipidomic profiles

  • Map identified interactions onto known signaling pathways

  • Develop network models of sphingolipid metabolism regulation

These approaches can reveal how sptB is integrated into cellular signaling networks, how its activity is regulated during development and stress responses, and how it coordinates with other sphingolipid metabolism enzymes to maintain membrane homeostasis in D. discoideum.

What are the most promising future research directions for D. discoideum sptB studies?

The study of D. discoideum sptB presents several promising research directions that could significantly advance our understanding of sphingolipid metabolism and its biological implications:

  • Structural Biology Approaches:

    • Determination of the three-dimensional structure of D. discoideum sptB alone and in complex with binding partners

    • Comparative structural analysis with human SPTLC2 to identify conserved and divergent features

    • Structure-guided drug design targeting sphingolipid biosynthesis

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, lipidomics, and transcriptomics

    • Network modeling of sphingolipid metabolism regulation during development and stress

    • Computational prediction of sphingolipid-protein interactions

  • Developmental Biology Applications:

    • Detailed characterization of sphingolipid dynamics during D. discoideum development

    • Investigation of sphingolipid-mediated signaling during cell differentiation

    • Analysis of membrane domain organization during multicellular formation

  • Stress Response Mechanisms:

    • Further exploration of the relationship between sphingolipid metabolism and protein aggregation resistance

    • Investigation of sphingolipid-dependent stress signaling pathways

    • Comparative analysis of stress responses in wild-type and sptB-modified strains

  • Therapeutic Applications:

    • Development of D. discoideum as a screening platform for sphingolipid metabolism modulators

    • Investigation of sphingolipid-targeted approaches for protein aggregation diseases

    • Exploration of evolutionary conserved mechanisms that could inform human disease treatment

These research directions leverage D. discoideum's unique advantages as a model organism while addressing fundamental questions about sphingolipid biology with broad implications for human health and disease.

How can collaborative research approaches advance our understanding of sphingolipid metabolism through D. discoideum sptB studies?

Advancing our understanding of sphingolipid metabolism through D. discoideum sptB studies will benefit significantly from interdisciplinary collaborative approaches:

  • Cross-disciplinary Integration:

    • Biochemists providing enzyme characterization expertise

    • Structural biologists determining protein structures

    • Cell biologists investigating cellular functions

    • Developmental biologists studying morphogenesis roles

    • Bioinformaticians analyzing multi-omics data

    • Evolutionary biologists providing phylogenetic context

  • Collaborative Technology Platforms:

    • Shared resources for high-throughput screening

    • Advanced imaging facilities for sphingolipid visualization

    • Mass spectrometry centers for comprehensive lipidomics

    • Computational resources for systems biology modeling

    • Genetic modification services for creating D. discoideum strains

  • Translational Research Partnerships:

    • Academic-industry collaborations for drug development

    • Clinical partnerships for connecting basic findings to human disease

    • Patient advocacy involvement to identify research priorities

    • Regulatory expertise to navigate the path to therapeutic applications

  • Knowledge Sharing Frameworks:

    • Standardized protocols for sphingolipid analysis

    • Open-access databases for sphingolipidomic data

    • Collaborative software tools for data integration

    • Regular symposia focused on sphingolipid metabolism

    • Cross-training opportunities between laboratories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.