Recombinant Dictyostelium discoideum Sestrin homolog (DDB_G0279427)

Shipped with Ice Packs
In Stock

Description

Introduction

Dictyostelium discoideum is a cellular slime mold recognized as a valuable model organism in cell and developmental biology due to its straightforward life cycle and ease of handling . Recent studies suggest that Dictyostelium and other cellular slime molds could offer novel lead compounds for pharmacological and medical research .

Sestrin Homolog (DDB_G0279427)

The Dictyostelium discoideum genome contains a Sestrin homolog, identified as DDB_G0279427. Sestrins are a family of highly conserved stress-inducible proteins that play a role in regulating cellular stress responses and metabolism .

Sestrin’s Role in Stress Response

Sestrins are known to mediate cellular responses to stress. For example, Enhanced Sestrin expression can be achieved through Tanshinone 2A (T2A) treatment .

Sestrin and mTORC1 Activity

T2A treatment reduces general phosphorylation of PKB substrates, reducing it by 30.4% (p < 0.05) and 75.8% (p < 0.01) following 1 or 24 h, respectively, with similar effects seen with GefS phosphorylation levels, where acute treatment reduced protein levels to 11% and chronic treatment to 57% .

mTORC1 activity was assessed by Western blotting analysis of phosphorylation of one of its downstream substrates 4E-BP1 following 1 or 24 h treatment with T2A (25 µM) . In these assays, 1 h treatment did not reduce mTORC1 activity, but 24 h treatment caused a 42.1% reduction .

Sestrin and Cell Proliferation

Experiments show that while LY294002 treatment (14 µM) had no effect on cell proliferation, its combination with T2A (12 µM) further decreased cell proliferation as compared to T2A treatment alone in a way that appeared to be above additive . An isobolographic analysis confirmed a strong synergistic effect of the two compounds in reducing cell proliferation in D. discoideum .

Alternative Splicing in D. discoideum

D. discoideum has alternative splicing, which is regulated and important in its biology . Sequence analyses support earlier findings that D. discoideum has alternative splicing . The presence of alternatively spliced genes and splicing regulators in the D. discoideum genome provides opportunities for studying alternative splicing in this simple model organism .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its inclusion.
Synonyms
DDB_G0279427; Sestrin homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0279427
Target Protein Sequence
MISMGMTSKGQNVDGAPAGNSSSEWIISSSSSPFQANKRYSLDPPFGSDYSPPASPQNEL DPLSSYFLNLQSEDNDVRKTAIEYIINTLSNPDNEKLIKNHLPMIVVLSTESPFDDISEA FTNFLKPIQEKYHIPKQRTTVFTSESQLPPLNTDDELTRKLFQDVFLQHGRVNHLTRILG WHPQYLEKFLLAYNTIMRDPGPLPLHWRNYIGILAAARYKCSYIIALQEHEFLMNNGDAR WLQGIDHIPAKLKNLLKVIELLAHQPWLLPKLDIEYLVKGTDAWSIAELVHAMVLICTFL SLSGFVFCCGISPECGLSESNNLSSSFSLNDSDCEIEDTAATENTAKVMELLKNRRSQQQ DDDDDDQLHDRQQDFHNAGDDSQSSNNNTTTTTTTTTTTTTTTNTNTTSNSAGGGDSSSS TLSQSSDRMSDFSRYIGNNTMTHTDFDVSSKLYNIFSAQEYSWREHGYELVSRYFPDAAP LLDEEFSFVYTMTYYKFNNNTDIDTLPFRRAVWYYVQRVKGMLHDDYNYQEVNMFLSRSL KNFVKKAVCFPETIKRDDYSKLGYSLKPDEKCHLSLLAVCSHKQASLLYGLYSVMNYQNR R
Uniprot No.

Target Background

Function

May function as a negative feedback regulator of TOR function.

Database Links
Protein Families
Sestrin family
Subcellular Location
Nucleus. Cytoplasm.

Q&A

What is the Dictyostelium discoideum Sestrin homolog and why is it important for research?

The Dictyostelium discoideum Sestrin homolog (DDB_G0279427) is a stress-inducible protein that plays crucial roles in maintaining metabolic homeostasis and protecting cells under stress conditions. This protein is particularly important for research because:

  • It represents a simpler version of the highly conserved Sestrin family found across eukaryotes, making it valuable for evolutionary studies .

  • In Dictyostelium, a lower eukaryote, starvation stress initiates multicellular development, providing a unique model for studying stress responses .

  • The protein influences both AMPK and mTOR pathways, which are central to cellular metabolism regulation .

  • It offers insights into fundamental cellular processes like autophagy and reactive oxygen species (ROS) management that are conserved across species .

Unlike mammals that have three Sestrin genes (Sesn1-3), Dictyostelium has only one Sestrin-like gene, making it an excellent simplified model for understanding basic Sestrin functions .

What are the known functions of DDB_G0279427 in Dictyostelium discoideum?

Based on experimental evidence, the Sestrin homolog in Dictyostelium discoideum has several important functions:

  • Autophagy regulation: DdSesn promotes autophagy during starvation, as shown by reduced autophagic flux in knockout strains .

  • ROS management: Upon starvation, both DdSesn and ROS levels increase. Overexpression of DdSesn reduces ROS levels while knockout strains show increased ROS levels compared to wild type .

  • Growth regulation: Overexpression of DdSesn decreases cell growth and extends the lag phase, suggesting a role in growth inhibition during stress .

  • mTOR pathway modulation: Deletion of sesn showed increased p4EBP1 levels, indicating that DdSesn likely inhibits the mTOR pathway, similar to its mammalian counterparts .

These functions illustrate that even in this evolutionarily distant organism, the core functions of Sestrins in stress response appear to be conserved .

How does DDB_G0279427 compare structurally and functionally to mammalian Sestrins?

While the complete structural characterization of DDB_G0279427 is still pending (as noted in the "pending issues" section of research) , functional comparisons reveal important similarities and differences:

FeatureDDB_G0279427 (Dictyostelium)Mammalian Sestrins (Sesn1-3)
Number of genesSingle geneThree genes (Sesn1, Sesn2, Sesn3)
RegulationUpregulated during starvationRegulated by p53, FoxO, and stress conditions
mTOR pathwayInhibits mTOR signalingInhibits mTORC1 signaling
AMPK pathwayInfluences AMPKActivates AMPK
AutophagyPromotes starvation-induced autophagyPromotes autophagy through mTORC1 inhibition
ROS regulationReduces ROS levels during starvationPossesses antioxidant function, partly through Nrf2 pathway
Size601 amino acids (full length)Varies by isoform (~480-490 amino acids)

Despite evolutionary distance, the functional conservation suggests Sestrins play fundamental roles in cellular stress responses across species, making the Dictyostelium homolog valuable for understanding basic Sestrin mechanisms .

What are the recommended methods for expressing and purifying recombinant DDB_G0279427?

Based on published research, the following protocol has been successfully used for expressing and purifying recombinant DDB_G0279427:

Expression System:

  • The full-length protein (601 amino acids) can be expressed in E. coli with a His-tag .

  • Alternatively, a Twin Strep-Tag system has been used successfully for expression in mammalian HEK293 cells .

Purification Protocol for Twin Strep-Tagged DDB_G0279427:

  • Construct a fusion protein consisting of:

    • Human IL2 signal sequence (for ER insertion)

    • DDB_G0279427 coding sequence without signal sequence (amino acids 24-867)

    • C-terminal Twin-Strep-Tag®

  • Transiently transfect HEK293 cells with the construct.

  • Purify using MagStrep Streptactin XT beads according to manufacturer instructions (IBA Lifesciences #2-5090-002) .

This strategy yields functional protein that can be used for further characterization, antibody production, or functional studies. For researchers requiring large quantities, the E. coli expression system with His-tagging may be more cost-effective, though mammalian expression might better preserve some post-translational modifications .

How can CRISPR/Cas9 be used to generate DDB_G0279427 knockout or modified strains?

CRISPR/Cas9 has been successfully adapted for Dictyostelium, providing an efficient method for generating DDB_G0279427 knockout or modified strains. The recommended approach is:

Vector Construction:

  • Use an all-in-one vector containing both Cas9 and sgRNA.

  • Utilize the endogenous tRNA-processing system for expressing sgRNA, which is approximately 10 times more effective than the commonly used U6 promoter in Dictyostelium .

  • Design sgRNAs targeting the DDB_G0279427 locus.

Transfection and Selection:

  • Transiently express the all-in-one vector in Dictyostelium cells.

  • This transient expression approach has the advantage that the drug resistance cassette is not integrated into the genome .

  • Simple vector construction involves annealing two oligo-DNAs.

Mutation Detection:

  • Use mutation-specific PCR to identify successful editing events.

  • Expected mutation frequencies can range from 72.9% to 100% for individual genes .

  • Confirm mutations by sequencing the target sites for insertion/deletion mutations.

This CRISPR/Cas9 system enables efficient genome editing of DDB_G0279427 in Dictyostelium cells, allowing researchers to create knockout strains to study the protein's function or introduce specific modifications to examine structure-function relationships .

What assays can be used to study the autophagy-promoting function of DDB_G0279427?

To study the autophagy-promoting function of DDB_G0279427, researchers can employ several complementary assays that have been validated in Dictyostelium studies:

1. Autophagic Flux Measurement:

  • Monitor the conversion of LC3-I to LC3-II by western blotting in the presence and absence of lysosomal inhibitors.

  • Compare wild-type, DDB_G0279427 knockout, and overexpression strains to assess differences in autophagic flux .

2. p4EBP1 Levels Measurement:

  • Assess phosphorylation levels of 4EBP1, a downstream target of mTORC1, by western blotting.

  • Increased p4EBP1 levels in sesn-knockout cells indicate heightened mTORC1 activity, which negatively regulates autophagy .

3. AMPK Activity Assay:

  • Measure AMPK phosphorylation status, as Sestrins are known to influence AMPK activation.

  • Activated AMPK promotes autophagy while inhibiting mTORC1 .

4. Fluorescent Autophagy Reporters:

  • Express GFP-LC3 or RFP-GFP-LC3 to visualize autophagosome formation and autophagosome-lysosome fusion.

  • Quantify autophagosome formation under starvation conditions in different genetic backgrounds.

5. Starvation-Induced Autophagy Comparison:

  • Subject cells to nutrient deprivation and compare autophagy induction between wild-type and modified strains.

  • This approach is particularly relevant as DDB_G0279427 has been shown to promote autophagy specifically during starvation .

These assays provide a comprehensive assessment of how DDB_G0279427 modulates autophagy, particularly through its effects on the mTORC1 pathway and response to starvation stress .

How does DDB_G0279427 integrate into stress response pathways in Dictyostelium discoideum?

DDB_G0279427 functions as a central integrator of multiple stress response pathways in Dictyostelium discoideum, coordinating cellular metabolism, autophagy, and oxidative stress management:

mTOR Pathway Integration:

  • In contrast to expectations, mTORC1 activity (assessed by phosphorylation of S6 and ULK) increases during starvation stress in Dictyostelium.

  • DDB_G0279427 strongly inhibits this mTORC1 signaling during starvation, as evidenced by reduced S6 and ULK1 phosphorylation in overexpression strains .

  • This inhibition is critical for autophagy induction, as mTORC1-mediated ULK1 phosphorylation inhibits autophagy .

AMPK Pathway Interaction:

  • DDB_G0279427 likely influences AMPK activation during stress, though the precise molecular mechanism remains to be fully characterized .

  • The coordinated regulation of both AMPK (activation) and mTORC1 (inhibition) allows DDB_G0279427 to efficiently promote autophagy during starvation.

Oxidative Stress Response:

  • Upon starvation, both DDB_G0279427 and ROS levels increase in wild-type cells.

  • Overexpression of DDB_G0279427 reduces ROS levels during starvation, suggesting an antioxidant function independent of its canonical oxidoreductase activity .

  • This ROS regulation function appears to operate separately from the autophagy-promoting function.

Developmental Integration:

  • Uniquely in Dictyostelium, starvation stress initiates multicellular development.

  • DDB_G0279427 may function as a molecular link between starvation sensing and developmental progression, though this relationship needs further characterization .

This multifaceted integration positions DDB_G0279427 as a critical stress response coordinator that simultaneously manages catabolic processes (autophagy), anabolic signaling (mTORC1), and oxidative stress protection during Dictyostelium's stress response .

What is the relationship between DDB_G0279427's oxidoreductase activity and its autophagy-promoting function?

The relationship between DDB_G0279427's oxidoreductase activity and its autophagy-promoting function reveals a surprising functional separation that challenges previous assumptions:

Functional Separation Evidence:

  • Studies with the oxidoreductase-disrupting C130S mutation (equivalent to the C130 site in mammalian Sestrins) demonstrate that this mutation does not affect the ability of Sestrin to prevent stress-induced atrophy in muscle models .

  • This indicates that the antioxidant function and the autophagy-promoting/mTORC1-inhibiting functions may operate through distinct mechanisms.

Parallel Pathways Model:

  • Current evidence suggests DDB_G0279427 operates through at least two parallel pathways:

    • Redox Regulation Pathway: Manages ROS levels during stress

    • Autophagy Regulation Pathway: Inhibits mTORC1 and promotes autophagy

Potential Linking Mechanisms:

  • While functionally separable, these pathways may still interact through:

    • AMPK Activation: Oxidative stress can activate AMPK, which in turn inhibits mTORC1

    • Autophagy-Mediated ROS Control: Enhanced autophagy can remove damaged mitochondria (mitophagy), reducing ROS production

    • Transcriptional Cross-regulation: Stress-induced transcription factors may simultaneously upregulate both functions

Unanswered Questions:

  • How are regulation of redox balance and energy sensing by Sestrins linked at the molecular level?

  • What is the precise mechanism through which DDB_G0279427 activates AMPK?

This functional separation has significant implications for research, suggesting that therapeutic strategies targeting Sestrin functions might be able to independently modulate its autophagy-promoting and antioxidant activities .

How can transcriptomic analysis inform our understanding of DDB_G0279427's role during starvation stress?

Transcriptomic analysis offers powerful insights into DDB_G0279427's role during starvation stress by revealing its position within broader gene regulatory networks:

Methodological Approach:

  • RNA-seq Comparison: Compare transcriptomes of wild-type, DDB_G0279427 knockout, and overexpression strains under normal and starvation conditions.

  • Gene Set Enrichment Analysis (GSEA): Identify pathways and transcription factor binding sites enriched in Sestrin-regulated genes.

  • Hierarchical Clustering: Group genes with similar expression patterns to identify co-regulated modules.

Expected Insights:

  • Regulatory Networks: Identify transcription factors potentially regulating or regulated by DDB_G0279427.

  • Pathway Integration: Reveal how DDB_G0279427 fits within broader stress response pathways.

  • Novel Functions: Discover unexpected cellular processes influenced by DDB_G0279427.

Comparative Framework:
Based on mammalian Sestrin studies, transcriptomic analysis has revealed:

ConditionEnriched PathwaysTranscription Factor Binding Sites
Sestrin RegulationmTORC1 signaling, PI3K/AKT/mTORC1 regulationE12, Myc/Maz, Sp1, FoxO
Aging MuscleApoptosis, inflammation, PI3K/AKT/mTORC1 regulationFoxO, E12, Myc/Maz, Sp1
AtrogenesE3 ubiquitin-ligases, autophagy-related genesFoxO

Analytical Approaches:

  • Use tools like Morpheus for hierarchical clustering of expression values

  • Employ GSEA with the Molecular Signatures Database "hallmarks" and "transcription factor binding targets" gene sets

  • Generate bubble plots using ggplot2 in R or Seaborn in Python to visualize pathway enrichment

This transcriptomic approach would reveal how DDB_G0279427 orchestrates global gene expression changes during starvation, potentially identifying novel downstream effectors and feedback mechanisms central to Dictyostelium's stress response .

How can antibodies against DDB_G0279427 be developed and validated for research applications?

Developing and validating antibodies against DDB_G0279427 requires a systematic approach, as demonstrated by successful antibody development against other Dictyostelium proteins:

Development Strategy:

  • Antigen Preparation:

    • Express recombinant DDB_G0279427 with a purification tag (Twin Strep-Tag or His-tag)

    • Purify using appropriate affinity chromatography (MagStrep Streptactin XT beads for Twin Strep-tagged protein)

  • Antibody Generation Options:

    • Recombinant Antibody Approach:

      • Generate a synthetic VHH phage display library against the purified protein

      • After panning rounds, select VHH inserts and subclone into expression vectors

      • Produce as minibodies with VHH fused to an IgG Fc portion

    • Conventional Approach:

      • Immunize rabbits or other animals with the purified protein

      • Collect antisera and purify using protein A/G affinity chromatography

Validation Protocol:

  • ELISA Validation:

    • Coat purified DDB_G0279427 and control proteins (e.g., PldX-TST) on ELISA plates

    • Test antibody binding using serial dilutions

    • Include proper negative controls to ensure specificity

  • Western Blot Validation:

    • Run lysates from wild-type and DDB_G0279427 knockout Dictyostelium

    • Confirm specific band at expected molecular weight in wild-type that's absent in knockout

  • Immunoprecipitation Testing:

    • Use antibodies to immunoprecipitate DDB_G0279427 from Dictyostelium lysates

    • Confirm identity by mass spectrometry

  • Immunofluorescence Assessment:

    • Stain wild-type and knockout cells to verify specific subcellular localization

    • Validate pattern changes during starvation stress

This systematic approach, similar to that used for generating antibodies against Dictyostelium GAA protein, ensures highly specific antibodies suitable for multiple applications, from basic detection to functional studies .

What are the most promising research directions for understanding DDB_G0279427's role in Dictyostelium development?

Several promising research directions would significantly advance our understanding of DDB_G0279427's role in Dictyostelium development:

1. Developmental Timing Regulation:

  • Investigate how DDB_G0279427 influences the timing of developmental transitions during starvation-induced multicellular development

  • Compare developmental marker expression and morphological changes in wild-type, knockout, and overexpression strains

  • This direction is particularly relevant as starvation stress initiates multicellular development in Dictyostelium

2. Cell-Type Differentiation:

  • Examine if DDB_G0279427 affects the proportion of different cell types (stalk cells vs. spore cells) during development

  • Assess if it plays a role in the cell fate decisions that occur during Dictyostelium morphogenesis

  • This may reveal connections between metabolic sensing and cell fate determination

3. Autophagy-Development Connection:

  • Map the relationship between DDB_G0279427-mediated autophagy and developmental progression

  • Determine if autophagy inhibition phenocopies DDB_G0279427 knockout developmental phenotypes

  • This would establish whether autophagy promotion is the primary mechanism through which DDB_G0279427 influences development

4. Interactome Mapping:

  • Identify protein interaction partners of DDB_G0279427 during different developmental stages

  • Use proximity labeling techniques (BioID or APEX) coupled with mass spectrometry

  • Determine if interaction networks change during the transition from single-cell to multicellular states

5. Evolutionary Conservation Analysis:

  • Compare the developmental functions of DDB_G0279427 with Sestrin roles in other developmental models

  • This may reveal fundamental conserved connections between stress sensing and developmental regulation

These research directions would collectively illuminate how DDB_G0279427 serves as a molecular link between environmental stress sensing and the regulation of multicellular development, potentially revealing fundamental principles of developmental biology .

How does the study of DDB_G0279427 in Dictyostelium inform our understanding of mammalian Sestrin functions?

The study of DDB_G0279427 in Dictyostelium provides unique insights into mammalian Sestrin functions through several comparative advantages:

Evolutionary Perspective:

  • As a single Sestrin gene in a lower eukaryote, DDB_G0279427 likely represents the ancestral functions of Sestrins before gene duplication and specialization in mammals (which have Sesn1-3).

  • Conserved functions between Dictyostelium and mammals likely represent core, essential Sestrin activities that have been maintained for hundreds of millions of years .

Simplified Model System:

  • The presence of only one Sestrin gene in Dictyostelium eliminates functional redundancy issues that complicate mammalian studies.

  • This allows clearer interpretation of knockout phenotypes, as compensatory effects from other Sestrin family members are absent .

Functional Conservation Evidence:

  • Both DDB_G0279427 and mammalian Sestrins:

    • Are upregulated during stress

    • Inhibit mTORC1 signaling

    • Promote autophagy

    • Reduce ROS levels

  • This functional conservation validates Dictyostelium as a relevant model for basic Sestrin mechanisms .

Translational Implications:

  • Discoveries in Dictyostelium can guide mammalian research directions, particularly for:

    • Aging Research: Sestrins protect against aging-related pathologies across species

    • Stress Response: Understanding fundamental stress response mechanisms

    • Autophagy Regulation: Dissecting the evolutionary conserved core of autophagy control

Unique Developmental Context:

  • Dictyostelium's transition from unicellular to multicellular form during starvation provides a unique context to study how Sestrins integrate stress signals with developmental processes.

  • This may reveal previously unappreciated roles of mammalian Sestrins in development or tissue homeostasis .

By studying the simpler, ancestral-like Sestrin in Dictyostelium, researchers can identify core mechanisms that may be obscured by the complexity and redundancy of the mammalian system, ultimately informing therapeutic approaches targeting Sestrin functions in human disease .

What are the common challenges in expressing and purifying functional DDB_G0279427, and how can they be addressed?

Researchers working with DDB_G0279427 face several technical challenges during expression and purification, with specific solutions developed to address each issue:

Challenge 1: Protein Solubility Issues

  • Problem: DDB_G0279427, like other Sestrins, may form inclusion bodies when overexpressed in E. coli.

  • Solutions:

    • Express at lower temperatures (16-18°C) to slow folding and increase solubility

    • Use solubility-enhancing fusion tags like MBP (maltose-binding protein)

    • Consider mammalian expression systems, which have successfully yielded soluble protein

    • Optimize buffer conditions during purification to maintain solubility

Challenge 2: Maintaining Protein Activity

  • Problem: Purified DDB_G0279427 may lose functional activity during purification.

  • Solutions:

    • Include reducing agents (DTT or β-mercaptoethanol) to maintain potential redox-active sites

    • Add protease inhibitors to prevent degradation

    • Avoid multiple freeze-thaw cycles by aliquoting the purified protein

    • Consider using the Twin Strep-Tag system, which allows gentle elution conditions

Challenge 3: Low Expression Yields

  • Problem: Some researchers report low yields of full-length protein.

  • Solutions:

    • Optimize codon usage for the expression system

    • Consider using HEK293 suspension cells for expression, which have yielded approximately 70-110 mg/L for similar proteins

    • Use auto-induction media for E. coli expression to increase biomass

    • Express the protein as separate domains if full-length expression is problematic

Challenge 4: Verification of Functional Activity

  • Problem: Ensuring the purified protein retains native functions.

  • Solutions:

    • Develop activity assays based on known functions (e.g., mTORC1 inhibition assays)

    • Verify protein folding using circular dichroism spectroscopy

    • Test interaction with known binding partners

    • Confirm redox regulation capacity in appropriate assays

These strategies have been developed based on experience with DDB_G0279427 and similar proteins, allowing researchers to produce sufficient quantities of functional protein for structural studies, antibody production, and functional assays .

How can genetic redundancy and compensation be addressed when studying DDB_G0279427 function?

While Dictyostelium has only one Sestrin gene (DDB_G0279427) compared to three in mammals, researchers still need strategies to address potential compensatory mechanisms that may mask phenotypes:

Assessment Strategies:

1. Temporal Gene Expression Analysis:

  • Approach: Monitor expression changes of potential compensatory genes following DDB_G0279427 deletion

  • Method: RNA-seq comparing wild-type and knockout strains at different time points following starvation stress

  • Target Pathways: Focus on genes involved in autophagy, AMPK signaling, mTOR pathway, and oxidative stress response

2. Multipronged Functional Analysis:

  • Approach: Assess multiple functional outputs to overcome compensation in any single pathway

  • Parameters to Measure:

    • Autophagic flux

    • ROS levels

    • mTORC1 activity (p4EBP1 levels)

    • AMPK activation

    • Growth rates

  • This comprehensive approach revealed that despite potential compensation, DDB_G0279427 knockout still showed reduced autophagic flux and increased ROS levels

Genetic Manipulation Approaches:

1. Acute Gene Inactivation:

  • Strategy: Use inducible CRISPR/Cas9 or conditional knockout systems to achieve rapid gene inactivation, minimizing time for compensatory mechanisms

  • Advantage: Distinguishes immediate effects from adaptive responses

  • Implementation: Adapt the efficient CRISPR/Cas9 system developed for Dictyostelium with inducible promoters

2. Double/Triple Knockout Approach:

  • Strategy: Simultaneously disrupt DDB_G0279427 and potential compensatory pathways

  • Targets: Consider knocking out DDB_G0279427 alongside key autophagy regulators, AMPK components, or antioxidant systems

  • Analysis: Compare phenotypic severity to single knockouts to identify synergistic effects

3. Domain-Specific Mutants:

  • Strategy: Generate specific point mutations rather than complete gene deletion

  • Approach: Create mutations in functional domains (e.g., mTORC1 binding) while leaving other functions intact

  • Benefit: Reveals domain-specific functions that might be masked by compensation in complete knockouts

These strategies collectively provide a robust framework for dissecting DDB_G0279427 functions despite potential genetic compensation, leading to more accurate characterization of its roles in Dictyostelium biology .

What bioinformatic approaches can identify potential interacting partners and evolutionary relationships of DDB_G0279427?

Advanced bioinformatic approaches can reveal both functional interactions and evolutionary insights about DDB_G0279427:

Structural Prediction and Analysis:

  • Protein Structure Prediction:

    • Use AlphaFold2 or RoseTTAFold to generate structural models of DDB_G0279427

    • Compare with known structures of mammalian Sestrins to identify conserved domains

    • Map conservation onto structural models to identify functional surfaces

  • Molecular Docking Simulations:

    • Predict interactions with known partners (e.g., GATOR components, AMPK)

    • Identify potential binding pockets for small molecules

    • Model conformational changes upon binding

Interactome Analysis:

  • Network-Based Approaches:

    • Apply protein-protein interaction prediction algorithms trained on evolutionary coupling data

    • Use tools like STRING database for initial interaction network generation

    • Validate top candidates experimentally

  • Co-expression Network Analysis:

    • Analyze transcriptomic datasets to identify genes co-expressed with DDB_G0279427

    • Use weighted gene co-expression network analysis (WGCNA) to identify modules

    • Focus on genes showing similar expression patterns during starvation stress

Evolutionary Analysis:

  • Phylogenetic Profiling:

    • Construct comprehensive phylogenetic trees of Sestrin proteins across species

    • Map functional domains onto phylogenetic trees to track domain evolution

    • Identify lineage-specific adaptations in Dictyostelium Sestrin

  • Conserved Motif Identification:

    • Use MEME Suite to identify conserved sequence motifs across Sestrin homologs

    • Compare conservation patterns to identify functionally important regions

    • Focus on regions showing different conservation patterns between Dictyostelium and mammals

Functional Site Prediction:

  • Post-translational Modification Sites:

    • Predict phosphorylation, acetylation, ubiquitination sites

    • Compare to experimentally validated sites in mammalian Sestrins

    • Identify potential regulatory mechanisms

  • Functional Domain Analysis:

    • Use InterProScan to identify and compare functional domains

    • Map critical residues for mTORC1 binding, AMPK interaction, and ROS regulation

These complementary bioinformatic approaches can guide experimental work by identifying the most promising interacting partners and evolutionary relationships, ultimately accelerating our understanding of DDB_G0279427 function in both Dictyostelium and broader evolutionary context .

What emerging technologies could advance our understanding of DDB_G0279427 function?

Several cutting-edge technologies hold particular promise for elucidating DDB_G0279427 functions:

Structural Biology Advances:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determine the 3D molecular structure of DDB_G0279427 alone and in complexes

    • Address the pending question: "What is the 3D molecular structure of Sestrins?"

    • Reveal conformational changes during protein interactions

  • Integrative Structural Biology:

    • Combine X-ray crystallography, NMR, and cross-linking mass spectrometry

    • Generate comprehensive structural models of DDB_G0279427 interactomes

    • Map interaction surfaces with binding partners

Single-Cell Technologies:

  • Single-Cell RNA Sequencing:

    • Profile transcriptional heterogeneity during Dictyostelium development

    • Identify cell populations where DDB_G0279427 plays critical roles

    • Track developmental trajectories in wild-type versus knockout strains

  • Single-Cell Proteomics:

    • Monitor protein-level changes in signaling pathways at single-cell resolution

    • Capture cellular heterogeneity in responses to starvation

Proximity Labeling Proteomics:

  • BioID or APEX2 Fusion Proteins:

    • Generate DDB_G0279427-BioID fusion to identify proximal proteins in living cells

    • Map dynamic interactome changes during starvation stress

    • Discover novel binding partners and complexes

In Situ Structural Analysis:

  • Live-Cell Super-Resolution Microscopy:

    • Visualize DDB_G0279427 localization at nanometer resolution

    • Track dynamic changes in protein complexes during stress responses

    • Map spatial relationships with mTORC1, lysosomes, and autophagosomes

Genome Editing Advances:

  • Prime Editing:

    • Make precise nucleotide changes without double-strand breaks

    • Introduce specific point mutations to test structure-function hypotheses

    • Adapt the technology for efficient use in Dictyostelium

These emerging technologies will address critical unresolved questions about DDB_G0279427, including its precise molecular mechanism of AMPK activation, the relationship between redox balance and energy sensing, and the mechanism of autophagy regulation .

How can research on DDB_G0279427 in Dictyostelium contribute to therapeutic applications for human diseases?

Research on DDB_G0279427 in Dictyostelium has significant translational potential for human disease applications:

Aging and Age-Related Diseases:

  • Sestrins prevent atrophy of disused and aging muscles through coordinated regulation of anabolic and catabolic pathways .

  • The simplified Dictyostelium system allows identification of core regulatory mechanisms that could be targeted to prevent sarcopenia (age-related muscle loss).

  • Understanding the stress-responsive aspects of DDB_G0279427 could inform interventions for multiple age-related conditions.

Neurodegenerative Disorders:

  • Autophagy dysfunction is implicated in diseases like Alzheimer's, Parkinson's, and Huntington's.

  • Insights into how DDB_G0279427 regulates autophagy could lead to therapeutic approaches that enhance clearance of protein aggregates.

  • Identification of small molecules that modulate Sestrin activity could be screened using Dictyostelium as an initial model system.

Metabolic Disorders:

  • The role of DDB_G0279427 in regulating AMPK and mTORC1 directly relates to metabolic homeostasis.

  • Discoveries may inform treatments for conditions like diabetes, obesity, and metabolic syndrome.

  • The simplified signaling networks in Dictyostelium allow clearer delineation of pathway interactions.

Cancer:

  • The pending research question "How is the expression of Sestrins changed in different types of cancer?" could be approached using insights from Dictyostelium.

  • Understanding fundamental mechanisms of mTORC1 regulation by DDB_G0279427 may reveal new therapeutic targets.

  • The role of Sestrins in stress responses may inform cancer treatments that induce stress states in tumors.

Translational Research Pipeline:

  • Identify core mechanisms in Dictyostelium

  • Validate conservation in mammalian models

  • Screen for small molecules that modulate Sestrin function

  • Develop targeted therapeutics based on structural insights

  • Test in disease-specific models

This research trajectory demonstrates how basic studies in Dictyostelium can ultimately contribute to addressing major human health challenges through deepened understanding of fundamental biological mechanisms .

What are the most critical unanswered questions about DDB_G0279427 that future research should address?

Several critical unanswered questions about DDB_G0279427 warrant focused investigation:

Structural Mechanisms:

  • 3D Structural Determination:

    • What is the complete three-dimensional structure of DDB_G0279427?

    • How does this structure compare to mammalian Sestrins?

    • Which structural elements are responsible for different functions?

Molecular Mechanisms:

  • AMPK Activation Mechanism:

    • What is the precise molecular mechanism underlying DDB_G0279427-induced activation of AMPK?

    • Does it involve direct binding, indirect pathways, or both?

    • How does this mechanism differ from mammalian Sestrin-AMPK interactions?

  • Autophagy Regulation:

    • What is the detailed mechanism of autophagy regulation by DDB_G0279427?

    • Does it involve additional proteins beyond mTORC1 inhibition?

    • How does DDB_G0279427 coordinate with other autophagy regulators?

Functional Integration:

  • Redox-Metabolism Connection:

    • How are regulation of redox balance and energy sensing by DDB_G0279427 linked at the molecular level?

    • Do these functions involve separate domains or integrated mechanisms?

    • How did these dual functions evolve?

  • Development-Metabolism Link:

    • How does DDB_G0279427 specifically influence Dictyostelium's transition from unicellular to multicellular development?

    • What developmental genes are regulated downstream of DDB_G0279427?

    • Is this connection between stress sensing and development conserved in other systems?

Evolutionary Aspects:

  • Functional Diversification:

    • How did the single Sestrin gene in Dictyostelium evolve into three specialized Sestrins in mammals?

    • Which functions are ancestral and which are derived?

    • Are there isoform-specific functions that emerged after gene duplication?

Translational Questions:

  • Therapeutic Modulation:

    • Can we identify small molecules that specifically modulate different functions of Sestrins?

    • Would these have therapeutic potential for age-related diseases?

    • How would findings in Dictyostelium translate to mammalian systems?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.