Recombinant Dictyostelium discoideum Signal peptidase complex subunit 2 (spcs2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
spcs2; spc2; DDB_G0270510; Signal peptidase complex subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
spcs2
Target Protein Sequence
MSTTTTTTTTEKPIQVTLYDSNTIKQTLDDSIVKYVTSALSYTQNQKLNYTKVLFGLIGC TLAAIAQFYPIPFPKNKPVLILCVALYVVISLILYYINIFIQKDYILQASKSNDEIKVAT VLQKYDPNYQVKIENAKNSSINVPFSKSIDLYFDTKGTFLESNFHNDLSVQFKKFAKLNV KDK
Uniprot No.

Target Background

Function
A component of the microsomal signal peptidase complex. It functions to remove signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.
Database Links
Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism for studying protein processing?

D. discoideum is a social amoeba that has emerged as a powerful model system in molecular biology. It offers several advantages that make it particularly suitable for protein processing studies:

  • Genetic tractability with a relatively small genome that facilitates genetic screens

  • Limited redundancy in gene families compared to mammalian systems, reducing experimental complexity

  • Conservation of many proteins previously thought to be restricted to vertebrates

  • A unique developmental cycle transitioning from unicellular to multicellular forms, providing opportunities to study protein processing during different life stages

  • Well-characterized cell signaling pathways that depend on properly processed secreted proteins

These characteristics make D. discoideum an excellent model for investigating fundamental aspects of protein processing, including the function of signal peptidase complexes.

How does the structure of spcs2 relate to its function in signal sequence processing?

Based on insights from yeast studies and molecular dynamics simulations:

  • Spcs2 appears to modulate the membrane environment surrounding the SPC

  • Membrane thinning at the center of the SPC is reduced without Spc2, suggesting a molecular mechanism for altered substrate recognition

  • The transmembrane domains of spcs2 likely create specific membrane distortions that facilitate substrate processing

  • The arrangement of spcs2 within the complex may create optimal spatial positioning for signal sequence recognition and cleavage

These structural features highlight how spcs2 functions not just as a passive scaffold within the SPC but actively contributes to creating the optimal environment for signal sequence processing.

How does spcs2 function compare between D. discoideum and other model organisms?

Comparative analysis reveals important insights:

  • The core catalytic mechanism of signal peptidase is likely conserved across eukaryotes, including D. discoideum

  • In yeast, Spc2 modulates substrate selection and cleavage site identification, with particular effects on sequences with different n-region lengths

  • Yeast cells lacking Spc2 show decreased cleavage of signal sequences with short n-regions (N# < 16) and increased cleavage of those with long n-regions (N# > 16)

  • D. discoideum's position in evolutionary history between unicellular and multicellular organisms suggests its SPC may show intermediate features between yeast and higher eukaryotes

Understanding these similarities and differences can inform experimental design when using D. discoideum as a model system for signal sequence processing.

What experimental approaches are used to study recombinant D. discoideum spcs2?

Common methodologies include:

  • Heterologous expression in bacterial, yeast, or insect cell systems

  • Addition of affinity tags (His, FLAG, or Strep) to facilitate purification

  • Construction of fluorescently-tagged versions for localization studies

  • In vitro reconstitution of the SPC using purified components

  • Mutagenesis studies to identify functionally important residues

  • Co-immunoprecipitation to identify interaction partners

  • Cell-free translation systems to assess signal sequence processing activity

These approaches allow researchers to investigate both the biochemical properties and cellular functions of spcs2.

What are optimal expression strategies for recombinant D. discoideum spcs2?

Expression of recombinant D. discoideum spcs2 requires careful consideration of several factors:

Expression SystemAdvantagesLimitationsOptimization Strategies
D. discoideumNative folding environment; Proper post-translational modificationsLower yield; Specialized equipment requiredUse of strong promoters (actin15); Optimize codon usage; N-terminal signal sequence
E. coliHigh yield; Simple cultivation; Cost-effectivePotential misfolding; Lack of post-translational modificationsFusion with solubility tags (MBP, SUMO); Low-temperature expression (16-20°C); Specialized strains (e.g., Rosetta, C41/C43)
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing; ScalableDifferent glycosylation patternsOptimize signal sequences; Methanol-inducible promoters for P. pastoris
Insect cellsComplex eukaryotic processing; Higher yield than mammalian cellsMore expensive than microbial systemsBaculovirus expression vector system; Optimization of MOI and harvest time

For membrane proteins like spcs2, detergent screening for solubilization is critical regardless of the expression system chosen. Consideration should also be given to using amphipols or nanodiscs for stabilization after purification.

How can researchers determine whether D. discoideum spcs2 recognizes specific signal sequences?

Signal sequence recognition can be systematically investigated through:

  • In vitro cleavage assays:

    • Construct model substrates with varying signal sequence characteristics

    • Compare processing efficiency with wild-type and mutant/depleted spcs2

    • Analyze cleavage products by SDS-PAGE and mass spectrometry

  • Cell-based reporter systems:

    • Create fusion proteins with signal sequences of interest linked to reporter proteins

    • Quantify secretion efficiency in cells with normal or altered spcs2 levels

    • Assess processing using antibodies specific to cleaved vs. uncleaved forms

  • Comparative analysis of signal sequences:

    • Examine processing of signal sequences with varying n-region lengths, as Spc2 in yeast affects processing depending on n-region length

    • Test processing of naturally occurring D. discoideum signal sequences

The data from yeast studies suggests that Spc2 promotes cleavage of signal sequences with short n-regions (N# < 16) and reduces cleavage of those with long n-regions (N# > 16) , providing a framework for similar studies in D. discoideum.

How does the membrane environment influence spcs2 function in D. discoideum?

Molecular dynamics simulations of yeast SPC provide valuable insights:

  • Membrane thinning at the center of SPC is reduced without Spc2, suggesting a molecular mechanism for altered substrate recognition

  • This membrane modulation likely affects how signal sequences are presented to the catalytic site

Researchers can investigate these effects in D. discoideum through:

  • Reconstitution of recombinant SPC components in liposomes of defined composition

  • Fluorescence-based membrane fluidity assays in the presence/absence of spcs2

  • Molecular dynamics simulations of D. discoideum spcs2 based on structural predictions

  • Experimental manipulation of membrane composition to assess effects on spcs2 function

Understanding how spcs2 interacts with and modifies the membrane environment is critical for elucidating its role in signal sequence processing.

What methodologies are effective for studying the impact of spcs2 mutations on D. discoideum development?

Given D. discoideum's complex developmental cycle, several approaches can be employed:

  • Generation of conditional mutants:

    • Temperature-sensitive alleles to enable stage-specific inactivation

    • Tetracycline-inducible expression systems for temporal control

    • CRISPR/Cas9-mediated genome editing for precise mutations

  • Developmental phenotyping:

    • Time-lapse imaging of the multicellular developmental cycle

    • Analysis of gene expression patterns using RNA-seq during development

    • Assessment of specific developmental markers by immunostaining

    • Quantification of developmental timing and morphological parameters

  • Cell signaling analysis:

    • Monitoring secretion and processing of key developmental signals like PSF

    • Examining effects on cAMP signaling pathways essential for development

    • Testing cell-cell communication through mixing experiments with labeled cells

Developmental defects might reveal specific substrates particularly dependent on proper spcs2 function for their processing and secretion.

How can structural biology approaches contribute to understanding D. discoideum spcs2 function?

Advanced structural techniques offer powerful insights:

  • Cryo-electron microscopy: Can reveal the organization of spcs2 within the SPC and how it interfaces with the membrane

  • X-ray crystallography: May elucidate specific domains of spcs2, particularly soluble portions

  • NMR spectroscopy: Useful for studying dynamic regions and ligand interactions

  • AlphaFold2 prediction: Can generate structural models based on sequence information when experimental structures are unavailable

  • Molecular dynamics simulations: Allow investigation of how spcs2 affects membrane properties, similar to studies in yeast showing membrane thinning effects

These structural insights can guide rational mutagenesis to test hypotheses about spcs2 function and mechanism.

What protein-protein interactions are critical for spcs2 function in the signal peptidase complex?

Understanding the interactome of spcs2 is essential:

  • Interactions within the SPC:

    • Mapping interaction interfaces between spcs2 and other SPC subunits

    • Identifying residues critical for complex assembly and stability

    • Determining how spcs2 positions the catalytic subunit for optimal activity

  • Interactions with the translocation machinery:

    • Potential contacts with the Sec61 translocon or associated factors

    • Coordination with signal recognition particle (SRP) components

    • Interactions that facilitate substrate delivery to the catalytic site

  • Experimental approaches:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling methods (BioID, APEX) to identify nearby proteins

    • Crosslinking mass spectrometry to map specific interaction sites

    • Yeast two-hybrid or mammalian two-hybrid screens for direct binding partners

These interactions may reveal how spcs2 coordinates signal sequence processing with other cellular processes.

How can comparative genomics enhance our understanding of D. discoideum spcs2 evolution and function?

Evolutionary analysis provides context for functional studies:

  • D. discoideum occupies an interesting evolutionary position between unicellular and multicellular organisms

  • Comparison with spcs2 sequences across diverse taxa can identify:

    • Universally conserved residues likely critical for core functions

    • Lineage-specific adaptations that may reflect specialized roles

    • Co-evolutionary patterns with other SPC components

Research approaches include:

  • Phylogenetic analysis of spcs2 across eukaryotic lineages

  • Identification of conservation patterns at the sequence and structural levels

  • Functional complementation experiments between species

  • Correlation between spcs2 sequence features and proteome characteristics

These analyses can guide experimental design by highlighting the most functionally significant aspects of spcs2.

What is the role of spcs2 in quality control within the secretory pathway?

Signal peptidase function intersects with quality control mechanisms:

  • Improper signal sequence cleavage can trigger ER-associated degradation (ERAD)

  • Spcs2 may help ensure accurate processing to prevent accumulation of misfolded proteins

  • Alterations in spcs2 function could potentially activate the unfolded protein response

Experimental approaches to investigate these connections include:

  • Monitoring ER stress markers in cells with altered spcs2 function

  • Assessing ubiquitination patterns of secretory proteins

  • Measuring the half-life of model substrates with various signal sequences

  • Analysis of genetic interactions between spcs2 and components of ER quality control machinery

Understanding this role could provide insights into how cells balance efficient protein processing with quality control mechanisms.

How might D. discoideum spcs2 function affect intercellular signaling during development?

D. discoideum development depends on numerous secreted signals:

  • Secreted factors like PSF coordinate multicellular development

  • Signal sequence processing is essential for the proper secretion of these factors

  • Spcs2 may modulate which signals are efficiently processed and secreted

Potential approaches for investigation include:

  • Analysis of secretome composition in wild-type versus spcs2-mutant cells

  • Targeted assessment of known developmental signals in spcs2-altered strains

  • Cell mixing experiments to test non-cell-autonomous developmental defects

  • Time-lapse imaging of developmental progression with fluorescent markers for key signaling molecules

These studies could reveal how spcs2 contributes to the complex cell-cell communication essential for D. discoideum development .

What therapeutic relevance might insights from D. discoideum spcs2 research have?

While primarily a basic research model, findings from D. discoideum spcs2 studies may have broader implications:

  • Understanding fundamental mechanisms of signal sequence processing relevant to human disease

  • Potential insights into congenital disorders of glycosylation or other secretory pathway diseases

  • Identification of conserved features that could be targeted for antimicrobial development

  • Model for studying how alterations in signal sequence processing affect cellular stress responses

The genetic tractability of D. discoideum makes it valuable for testing hypotheses about signal peptidase function that might be difficult to address directly in mammalian systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.