Recombinant Dictyostelium discoideum Sphingosine-1-phosphate lyase (sglA)

Shipped with Ice Packs
In Stock

Description

Introduction

Sphingosine-1-phosphate lyase (SPL), particularly the recombinant form from Dictyostelium discoideum (sglA), plays a crucial role in sphingolipid metabolism and various cellular processes . Sphingosine-1-phosphate (S-1-P) is a bioactive sphingolipid that functions in both extracellular and intracellular signaling pathways . S-1-P lyase, encoded by the sglA gene in Dictyostelium discoideum, is responsible for the degradation of S-1-P into phosphoethanolamine and hexadecanal, thus regulating the levels of S-1-P within the cell .

Function and Mechanism

Sphingosine-1-phosphate lyase (sglA) catalyzes the final step in the sphingomyelin degradation pathway . The enzyme cleaves S-1-P, a product of sphingomyelin degradation, which is an important element of signal transduction pathways that regulate cell proliferation and cell death .

The generalized reaction is:
$$
\text{Sphingosine-1-phosphate} + H_2O \rightarrow \text{Phosphoethanolamine} + \text{Hexadecanal}
$$

In normal cells, the degradation of sphingoid bases, via the action of sphingosine-1-phosphate lyase, occurs at the C2-C3 position of the sphingoid base .

Role in Dictyostelium discoideum Development

In Dictyostelium discoideum, sphingosine-1-phosphate lyase (sglA) is essential for proper growth and multicellular development . Disruption of the sglA gene in Dictyostelium discoideum results in a mutant strain exhibiting aberrant morphogenesis and increased viability during the stationary phase . The absence of sphingosine-1-phosphate lyase affects multiple stages throughout development, including:

  • The cytoskeletal architecture of aggregating cells

  • The ability to form migrating slugs

  • The control of cell type-specific gene expression

  • Terminal spore differentiation

  • Suppression of lateral pseudopod formation during cell migration and chemotaxis

Impact on Cisplatin Sensitivity

Studies using Dictyostelium discoideum have demonstrated that sphingolipids are key regulators of sensitivity to cisplatin and other anticancer drugs . A Dictyostelium discoideum mutant with a disruption in the sphingosine-1-phosphate (S-1-P) lyase gene was obtained through random insertional mutagenesis for mutants with increased resistance to cisplatin . Cells overexpressing sphingosine kinase or null for S-1-P lyase are less sensitive to cisplatin, while cells null for sphingosine kinase or overexpressing S-1-P lyase are more sensitive to cisplatin .

Experimental Models and Tools

The creation of sphingosine-1-phosphate lyase (SGPL1) knockout cell lines, using CRISPR-Cas9, provides a valuable tool to study sphingolipid metabolism and protein-sphingolipid interactions . These knockout cell lines exhibit minimal adaptations in lipid and protein compositions, making them suitable models for studying transient protein-sphingolipid interactions .

Clinical Significance

Pharmacological intervention in sphingolipid metabolism, such as the inhibition of sphingosine kinase, can synergistically sensitize cells to cisplatin, both in D. discoideum and human cells . Modulating the sphingolipid pathway at multiple points can increase sensitivity to cisplatin, offering the potential to improve the clinical usefulness of this drug .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sglA; DDB_G0282819; Sphingosine-1-phosphate lyase; S1P lyase; S1PL; SP-lyase; SPL; Sphingosine-1-phosphate aldolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
sglA
Target Protein Sequence
MDKANDYLKDYQPAKLVLATAGITAASILAYQAITDRDFKDKLNKKIFRSIKSMPGVSDI VKKERAKAKVELKKMFKTDVRNAHYTLPLKGIKHEDLIEEMKALAKVDESHWVDSKVSGC VYLGEKEHTKLLNEAYSLFSLSNPLHPSVFPSIRKFETESISMVSNMLNAHSKVVGSLTS GGTESIFMAVKAYRDFYKDRTDRPEIVVPVTIHAAFDKACEYLKIRIVHIDVDPVSYKVD MAAMKKAINKDTILVAGSAVNFPHGIIDPIDEIAKLAQQYDIGCHVDACLGGFILPFAEK LDYDIPVFDFRIPGVTSMSVDTHKFGYAAKGTSVVLFGNKKLRRAMYFVAPNWPGGIYAS PTLPGSRPGGLVAACWASLVSMGNDGFLEKAKGVMETTKKIIKGLQSINGVKIIGDPKAM VVAFTCDNIFYVNDYMSKKGWHLNALQRPNSLHVCVTAKMIGMESLFIEDLKDSIKLVKD NSGSLPKDGTAPIYGSAHSVPDREMVGTILSDFIDELITPDYKPSQST
Uniprot No.

Target Background

Function
This recombinant *Dictyostelium discoideum* Sphingosine-1-phosphate lyase (sglA) cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate (S1P), into fatty aldehydes and phosphoethanolamine. S1P likely functions intracellularly as a second messenger, potentially by stimulating cell proliferation. S1P lyase deficiency leads to elevated S1P levels, resulting in increased lateral pseudopod formation and impaired chemotaxis efficiency. Conversely, S1P lyase overexpression reduces growth rates, accelerates entry into stationary phase at lower cell densities, and increases sensitivity to antitumor agents such as cisplatin and carboplatin. These effects are more pronounced in cells expressing higher enzyme levels.
Database Links
Protein Families
Group II decarboxylase family, Sphingosine-1-phosphate lyase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Sphingosine-1-phosphate lyase (sglA) and what is its primary function in Dictyostelium discoideum?

Sphingosine-1-phosphate lyase (sglA) is an enzyme that degrades Sphingosine-1-phosphate (S-1-P) in Dictyostelium discoideum. It plays a critical role in sphingolipid metabolism by regulating intracellular levels of S-1-P, which functions as a second messenger in various cellular signaling pathways. The enzyme catalyzes the irreversible degradation of S-1-P, thereby terminating its signaling effects. In D. discoideum, sglA has been implicated in modulating sensitivity to anti-cancer drugs, particularly cisplatin, as evidenced by mutants lacking sglA demonstrating increased resistance to cisplatin compared to wild-type cells .

How does sglA relate to sphingosine kinases in Dictyostelium discoideum?

In Dictyostelium discoideum, sglA functions in opposition to sphingosine kinases (SgkA and SgkB), which synthesize S-1-P from sphingosine and ATP. These enzymes collectively regulate the balance of sphingolipid metabolites in the cell. D. discoideum possesses two sphingosine kinase genes—sgkA and sgkB—that are homologous to human SPHK1 and SPHK2, respectively. The interplay between these kinases and sglA creates a regulatory network that modulates cellular responses to external stimuli. Specifically, while sglA degrades S-1-P, the sphingosine kinases produce it, establishing a dynamic equilibrium that influences cisplatin sensitivity through second-messenger signaling mechanisms .

What methodologies are recommended for recombinant expression of sglA?

For recombinant expression of sglA in D. discoideum, researchers should consider the following methodological approach:

  • Vector Selection: Use vectors designed for D. discoideum expression, such as those containing appropriate promoters (e.g., actin15 promoter) and selection markers.

  • Transformation Method: Electroporation is typically the most efficient method for introducing recombinant DNA into D. discoideum cells.

  • Cultivation Conditions: Grow transformed cells in HL5 medium with appropriate supplements for auxotrophy or drug selection, maintaining exponentially growing cultures at approximately 2 × 10^6 cells per milliliter .

  • Expression Verification: Confirm successful expression through Western blotting using antibodies against sglA or against epitope tags incorporated into the recombinant protein.

  • Activity Assay: Measure sglA activity by quantifying the degradation of labeled S-1-P substrates using chromatographic techniques.

How does deletion or overexpression of sglA affect transcriptional responses to cisplatin in D. discoideum?

Deletion of the sglA gene (sglA-) in D. discoideum significantly alters transcriptional responses to cisplatin treatment. Microarray analyses have revealed that cisplatin treatment is the dominant factor influencing gene expression patterns, as evidenced by the clustering of untreated samples separately from cisplatin-treated samples regardless of genotype. Interestingly, transcriptional profiles of sglA- mutants are more similar to wild-type cells than to sphingosine kinase overexpressor (sgkAOE) mutants, suggesting distinct mechanisms of cisplatin resistance between these two strains .

When treated with cisplatin, sglA- mutants exhibit differential expression of specific gene sets compared to wild-type cells, including those involved in stress responses and metabolic pathways. This indicates that sglA deletion does not render cells insensitive to cisplatin but rather modulates specific cellular pathways that contribute to drug resistance. Researchers investigating this phenomenon should employ global transcriptional profiling methods, such as RNA-seq or microarray analysis, followed by validation of key differentially expressed genes using RT-PCR .

What are the experimental approaches to study interactions between sglA and sphingosine kinases?

To study interactions between sglA and sphingosine kinases (SgkA and SgkB), researchers should consider these experimental approaches:

  • Genetic Manipulation: Create single and double knockout mutants (sglA-, sgkA-, sgkB-, sgkA-/sgkB-) as well as overexpression strains (sglAOE, sgkAOE) through homologous recombination. These genetic variants provide a foundation for comparative analyses .

  • Biochemical Assays: Measure enzyme activities in various mutants using standardized assays for sphingosine kinase and S-1-P lyase. This allows quantitative assessment of how perturbations in one enzyme affect the activity of others in the pathway .

  • Metabolite Profiling: Quantify sphingolipid metabolites (particularly S-1-P, sphingosine, and ceramide) using liquid chromatography-mass spectrometry (LC-MS) to determine how genetic manipulations alter the sphingolipid balance.

  • Drug Sensitivity Testing: Assess cisplatin sensitivity across mutant strains using survival assays at various drug concentrations. This reveals functional relationships between enzymes in the context of drug resistance mechanisms .

  • Rescue Experiments: Test whether adding exogenous S-1-P can reverse phenotypes in sphingosine kinase-null mutants, or whether sphingosine kinase inhibitors can reverse resistance in sglA- mutants .

What experimental controls are essential when analyzing cisplatin sensitivity in sglA mutants?

When analyzing cisplatin sensitivity in sglA mutants, the following experimental controls are essential:

  • Parental Wild-type Strain: Always include the original parental strain as the primary control to establish baseline cisplatin sensitivity.

  • Untreated Controls: For each strain tested, maintain parallel untreated samples to account for inherent differences in growth rates and viability between strains .

  • Concentration Gradient: Test multiple cisplatin concentrations (e.g., 75 μM, 150 μM, 300 μM) to establish dose-response relationships and identify optimal concentrations for detecting differences between strains .

  • Positive Control Mutants: Include previously characterized mutants with known cisplatin sensitivity profiles (e.g., sgkAOE showing increased resistance) as reference points.

  • Timing Controls: Standardize the timing of cisplatin treatment relative to cell growth phase, as sensitivity may vary depending on cell cycle stage.

  • Verification of Genetic Manipulation: Confirm gene deletion or overexpression at both DNA level (PCR) and protein level (Western blot) to ensure the observed phenotypes are due to the intended genetic changes.

  • Vehicle Controls: Include appropriate buffer controls (e.g., PT buffer used for cisplatin dissolution) to account for potential buffer effects .

What are the recommended protocols for measuring sglA enzyme activity?

For measuring Sphingosine-1-phosphate lyase (sglA) activity in Dictyostelium discoideum, researchers should follow these methodological steps:

  • Cell Lysis: Harvest cells from exponentially growing cultures and lyse them in buffer containing protease inhibitors to preserve enzyme activity.

  • Subcellular Fractionation: Separate membrane and cytosolic fractions through differential centrifugation, as sglA activity may be distributed across cellular compartments.

  • Substrate Preparation: Use radiolabeled S-1-P ([³²P]S-1-P or [³H]S-1-P) as a substrate to enable sensitive detection of enzyme activity.

  • Reaction Conditions:

    • Buffer: 50 mM HEPES (pH 7.4)

    • Co-factors: 2 mM DTT, 0.1 mM pyridoxal 5'-phosphate

    • Temperature: 30°C for D. discoideum enzymes

    • Incubation time: 30-60 minutes

  • Activity Quantification: Measure product formation using thin-layer chromatography or HPLC, calculating enzyme activity as pmol product formed per minute per mg protein.

  • Controls: Include heat-inactivated enzyme preparations as negative controls and known quantities of product standards for calibration.

How should researchers design experiments to study the relationship between sglA and cisplatin resistance?

To effectively study the relationship between sglA and cisplatin resistance, researchers should design experiments following these guidelines:

  • Genetic Variants: Create and validate multiple genetic variants:

    • sglA deletion mutants (sglA-)

    • sglA overexpression mutants (sglAOE)

    • Double mutants with sphingosine kinase genes (sglA-/sgkA-, sglA-/sgkB-)

    • Complemented strains where the sglA gene is reintroduced into sglA- mutants

  • Cisplatin Sensitivity Assays:

    • Determine cell survival after cisplatin treatment using standardized protocols

    • Test multiple cisplatin concentrations (75-300 μM range)

    • Measure survival at multiple time points post-treatment

    • Grow cells in shaking suspension in HL5 medium with appropriate supplements

  • Sphingolipid Manipulation:

    • Add exogenous S-1-P to test rescue of sensitivity phenotypes

    • Use sphingosine kinase inhibitors to manipulate S-1-P levels

    • Apply specific inhibitors like N,N-dimethylsphingosine to block relevant enzymes

  • Transcriptional Analysis:

    • Perform RNA isolation from untreated and cisplatin-treated cells

    • Use microarray or RNA-seq to identify differentially expressed genes

    • Validate key findings with RT-PCR on selected genes

  • Experimental Design Table:

StrainTreatment ConditionsMeasurementsControls
Wild-typeUntreated, 75 μM, 150 μM, 300 μM cisplatinSurvival rate, Gene expressionPT buffer
sglA-Untreated, 75 μM, 150 μM, 300 μM cisplatinSurvival rate, Gene expressionPT buffer
sglAOEUntreated, 75 μM, 150 μM, 300 μM cisplatinSurvival rate, Gene expressionPT buffer
sgkA-Untreated, 75 μM, 150 μM, 300 μM cisplatinSurvival rate, Gene expressionPT buffer
sgkAOEUntreated, 75 μM, 150 μM, 300 μM cisplatinSurvival rate, Gene expressionPT buffer

What analytical methods should be employed to interpret contradictory findings in sglA research?

When confronted with contradictory findings in sglA research, researchers should employ these analytical approaches:

  • Strain Authentication: Verify the genetic background of all strains through genomic PCR and sequencing to confirm the intended mutations are present and no unintended mutations have occurred.

  • Methodology Standardization: Examine differences in experimental protocols that may account for contradictory results, including:

    • Cell culture conditions and growth phase

    • Drug preparation and treatment protocols

    • Assay methods and detection techniques

  • Statistical Reanalysis:

    • Apply appropriate statistical tests (e.g., t-test, ANOVA) with corrections for multiple testing

    • Calculate effect sizes to quantify the magnitude of differences

    • Perform power analysis to ensure adequate sample sizes for detecting biologically relevant differences

  • Meta-analytical Approach: Systematically compare results across multiple experiments and studies, weighting findings based on methodological rigor and sample size.

  • Complementary Techniques: Validate findings using multiple independent methods. For example, if transcriptional changes show contradictory patterns, validate with both microarray and RT-PCR, or supplement with protein-level analyses .

  • Conditional Effects Analysis: Investigate whether contradictions arise from context-dependent effects by systematically varying experimental conditions such as:

    • Cell density during treatment

    • Growth medium composition

    • Treatment duration

    • Presence of additional stressors

How should transcriptional profiling data be analyzed in the context of sglA and sphingolipid metabolism?

When analyzing transcriptional profiling data in the context of sglA and sphingolipid metabolism, researchers should follow this comprehensive analytical framework:

  • Quality Control and Normalization:

    • Assess RNA quality using metrics like RNA Integrity Number (RIN)

    • Apply appropriate normalization methods (e.g., quantile normalization for microarrays, TPM/FPKM for RNA-seq)

    • Remove batch effects using methods like ComBat or RUVSeq

  • Differential Expression Analysis:

    • Compare gene expression between experimental conditions (e.g., wild-type vs. sglA-, untreated vs. cisplatin-treated)

    • Apply statistical methods appropriate for the platform (e.g., limma for microarrays, DESeq2 for RNA-seq)

    • Use multiple testing correction (Benjamini-Hochberg procedure) with significance threshold of P < 0.05

  • Pathway Analysis:

    • Map differentially expressed genes to known biological pathways

    • Perform Gene Set Enrichment Analysis (GSEA) to identify coordinately regulated pathways

    • Focus on sphingolipid metabolism and related signaling pathways

  • Hierarchical Clustering and Visualization:

    • Create dendrograms to visualize relationships between samples

    • Use dimensionality reduction techniques (PCA, t-SNE) to identify major sources of variation

    • Generate heatmaps of differentially expressed genes to identify patterns

  • Validation Strategy:

    • Select representative genes for validation by RT-PCR

    • Choose genes from different expression patterns and functional categories

    • Compare fold-changes between microarray/RNA-seq and RT-PCR to confirm reliability

What are the key considerations for designing and analyzing drug sensitivity assays with sglA mutants?

When designing and analyzing drug sensitivity assays with sglA mutants, researchers should consider the following key factors:

  • Experimental Design Considerations:

    • Use isogenic strains that differ only in the targeted genetic modification

    • Include multiple biological replicates (minimum n=3) for statistical robustness

    • Test a range of cisplatin concentrations to establish complete dose-response curves

    • Maintain consistent cell density (2 × 10^6 cells/ml) during treatment

  • Assay Selection and Execution:

    • Choose appropriate viability assays (e.g., clonogenic survival, MTT, flow cytometry with viability dyes)

    • Standardize drug preparation to ensure consistent potency (verify concentration spectrophotometrically at 220 nm using extinction coefficient of 1.957 mM^-1^cm^-1)

    • Control for growth rate differences between strains by normalizing to untreated controls

  • Data Analysis Framework:

    • Calculate survival rates relative to untreated controls for each strain

    • Generate dose-response curves and determine IC50 values

    • Apply appropriate statistical tests (t-test or ANOVA) to compare sensitivity between strains

    • Quantify the degree of resistance/sensitivity using resistance factors (RF = IC50 mutant/IC50 wild-type)

  • Result Interpretation Guidelines:

    • Consider both statistical significance and magnitude of effect

    • Integrate findings with mechanistic hypotheses about sglA function

    • Contextualize results within the broader understanding of sphingolipid metabolism

How can researchers integrate findings from sglA studies with broader sphingolipid metabolism research?

To effectively integrate findings from sglA studies with broader sphingolipid metabolism research, researchers should employ these strategies:

  • Comparative Analysis Across Species:

    • Compare D. discoideum sglA function with homologous enzymes in other organisms

    • Identify conserved and divergent features of sphingolipid metabolism

    • Draw parallels between findings in D. discoideum and mammalian systems, particularly regarding cisplatin resistance mechanisms

  • Multi-omics Integration:

    • Combine transcriptomic data with proteomics and metabolomics analyses

    • Correlate changes in sglA expression/activity with alterations in the sphingolipid metabolite profile

    • Map relationships between sphingolipid pathway components and cellular phenotypes

  • Pathway Modeling Approaches:

    • Develop mathematical models of sphingolipid metabolism incorporating sglA

    • Use these models to predict effects of genetic or pharmacological interventions

    • Validate model predictions with targeted experiments

  • Translational Research Framework:

    • Identify potential therapeutic targets based on D. discoideum findings

    • Explore whether manipulation of sphingolipid metabolism could enhance cisplatin efficacy in cancer treatment

    • Test hypotheses derived from D. discoideum in mammalian cell culture and animal models

What are the established connections between sglA function and cisplatin resistance?

The relationship between Sphingosine-1-phosphate lyase (sglA) and cisplatin resistance has been firmly established through multiple lines of experimental evidence:

  • Genetic Evidence: Deletion of the sglA gene consistently results in increased resistance to cisplatin compared to wild-type cells. This indicates that the enzyme's normal function contributes to cisplatin sensitivity. Conversely, overexpression of sphingosine kinases (which oppose sglA function by producing S-1-P) also increases cisplatin resistance .

  • Biochemical Mechanism: The current model suggests that sglA regulates cisplatin sensitivity through modulation of S-1-P levels, which function as second messengers in cell signaling pathways. When sglA is deleted, S-1-P accumulates, activating protective signaling cascades that reduce cisplatin sensitivity .

  • Transcriptional Responses: Global gene expression analyses reveal that while cisplatin treatment dramatically alters the transcriptome in both wild-type and sglA- cells, the specific transcriptional responses differ between these strains. This suggests that sglA deletion does not prevent cells from detecting and responding to cisplatin but rather alters the nature of this response .

  • Pharmacological Validation: The addition of exogenous S-1-P can reverse the increased sensitivity to cisplatin observed in sphingosine kinase-null mutants, while sphingosine kinase inhibitors can reverse the resistance phenotype of sglA-null mutants .

What are the most promising directions for future research on recombinant sglA?

Future research on recombinant Sphingosine-1-phosphate lyase (sglA) should focus on these promising directions:

  • Structural Biology Approaches:

    • Determine the crystal structure of recombinant sglA to elucidate its catalytic mechanism

    • Identify potential binding sites for small molecule modulators

    • Engineer sglA variants with altered substrate specificity or regulatory properties

  • Systems Biology Integration:

    • Develop comprehensive models of sphingolipid metabolism incorporating quantitative data on enzyme kinetics

    • Use computational approaches to predict how perturbations in sglA activity propagate through the sphingolipid network

    • Identify leverage points in the pathway that could be therapeutically targeted

  • Translational Applications:

    • Investigate whether findings from D. discoideum can be directly applied to human cancer cells

    • Develop small molecule inhibitors or activators of Sphingosine-1-phosphate lyase

    • Test combinations of sphingolipid metabolism modulators with cisplatin to overcome drug resistance

  • Advanced Genetic Approaches:

    • Apply CRISPR-Cas9 technology to create precise modifications in sglA and related genes

    • Develop inducible expression systems to study temporal aspects of sglA function

    • Create reporter systems to monitor sglA activity in living cells

  • Cross-Species Functional Analysis:

    • Express human S1P lyase in D. discoideum sglA-null mutants to assess functional conservation

    • Use D. discoideum as a platform for screening mutations in human S1P lyase identified in clinical samples

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.