Recombinant Dictyostelium discoideum SrfA-induced gene J protein (sigJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sigJ; DDB_G0269254; SrfA-induced gene J protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
sigJ
Target Protein Sequence
MGRVEDQIKDNYNSLSHEGERLNREAKIESEKLKNNAKLDAKDMKKDIDESVHSSWETVK EGAKTVQDYISSGIESVKHTITTEPAQKDMENLKHNVNHNLEEAEKEGSSVLNNISNFFK GSAEEAKSEAERIGYEAYKDGDQFVGDVHKNFKRTANETQKDANRLTSDVKNESNKIYKD IKDESNKLYNDVKGESSKIYNGAKKEGSKLATDLKKDTQYVADETKKMAADLKNKAADTY QDLSHDASKKATQLKKKASETLDESADAIEHQFDIMKKDFRHLNQRNGMIWGSIGLIGGA TATSYLFPSASPMAKFTFIAGLASLGGYYGLHQPHNKIVDNAFHKANNKKEELKKKI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is sigJ and how is it regulated in Dictyostelium discoideum?

sigJ (SrfA-induced gene J protein) is a protein encoded by the gene DDB_G0269254 in Dictyostelium discoideum. It belongs to a group of genes whose expression is dependent on the MADS box transcription factor SrfA. Transcriptional analysis has demonstrated that sigJ is expressed exclusively during late developmental stages in wild-type D. discoideum but shows significantly reduced expression in srfA null strains .

The temporal expression pattern analysis by Northern blotting reveals that sigJ, like other SrfA-dependent genes (sigB, sigD, and 45D), is predominantly expressed at late developmental stages (20-24 hours after starvation) . This temporal regulation is consistent with SrfA's role in the late stages of Dictyostelium development, particularly during spore formation.

What developmental processes involve sigJ expression?

sigJ expression is tightly linked to the culmination and sporulation phases of D. discoideum development. Analysis of srfA-null mutants demonstrates that srfA is necessary for proper spore differentiation, particularly in the late steps of this process . Since sigJ expression is dependent on SrfA, it is likely involved in the same developmental processes.

In situ hybridization experiments with other SrfA-dependent genes (sigA, sigB, and sigD) have shown that their expression is restricted to the sorus of developing structures . This spatiotemporal expression pattern supports the hypothesis that sigJ plays a role in spore formation and maturation, potentially contributing to spore resistance to adverse environmental conditions .

How can recombinant sigJ protein be effectively expressed and purified?

Recombinant sigJ can be expressed using both prokaryotic (E. coli) and eukaryotic (D. discoideum) expression systems. For researchers requiring high yields and simplified purification:

E. coli Expression System:

  • Clone the sigJ coding sequence into an expression vector with a suitable tag (His-tag is commonly used as indicated in commercial preparations)

  • Transform into an appropriate E. coli strain optimized for protein expression

  • Induce expression with IPTG under optimized conditions

  • Lyse cells and purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Consider buffer optimization containing 50% glycerol for stability

D. discoideum Expression System:
For researchers interested in native post-translational modifications:

  • Clone sigJ into a D. discoideum expression vector with an appropriate secretion signal

  • Transform D. discoideum cells using standard electroporation protocols

  • Select stable transformants and grow in peptone-based medium

  • Harvest and purify the secreted protein from the culture medium

The D. discoideum system has been demonstrated to efficiently secrete recombinant proteins, with yields of up to 20mg/L for some proteins, though yields for sigJ specifically have not been published . The secretion signal peptide is correctly cleaved, and expression stability has been demonstrated for at least one hundred generations in the absence of selection for some recombinant proteins in D. discoideum .

What methods are optimal for studying sigJ function in vivo?

Several complementary approaches can be employed:

Gene Knockout Approach:

  • Generate sigJ knockout constructs using homologous recombination

  • Transform D. discoideum cells and select for gene disruption

  • Confirm deletion using PCR and Southern blotting

  • Analyze developmental phenotypes focusing on:

    • Spore formation and morphology

    • Spore resistance to adverse conditions

    • Developmental timing and fruiting body formation

    • Viability after exposure to environmental stressors

Expression Profiling:

  • Use RNA isolation with Trizol reagent at 2-hour intervals throughout development

  • Compare expression profiles between wild-type and sigJ-knockout strains

  • Analyze using microarray or RNA-seq technology

  • Normalize Cy3/Cy5 ratios of individual genes for microarray comparison

In situ Hybridization:
To determine the spatial expression pattern of sigJ:

  • Generate DIG-labeled RNA probes

  • Fix developing D. discoideum structures at different stages

  • Hybridize with the probe and visualize expression patterns

  • Compare with known expression patterns of other developmental genes

What techniques can be used to investigate protein-protein interactions involving sigJ?

To decipher the functional networks involving sigJ:

Yeast Two-Hybrid Screening:

  • Generate bait constructs with sigJ cDNA

  • Screen against a D. discoideum cDNA library

  • Validate positive interactions with secondary assays

Co-Immunoprecipitation:

  • Generate antibodies against sigJ or use tagged recombinant protein

  • Prepare lysates from developing D. discoideum cells

  • Immunoprecipitate sigJ and identify binding partners by mass spectrometry

  • Confirm interactions through reciprocal co-IP

Proximity Labeling Techniques:

  • Generate BioID or APEX2 fusion constructs with sigJ

  • Express in D. discoideum during development

  • Activate labeling during specific developmental stages

  • Purify biotinylated proteins and identify by mass spectrometry

How does sigJ contribute to spore resistance mechanisms?

The contribution of sigJ to spore resistance can be investigated systematically:

  • Comparative Phenotypic Analysis:

    • Compare wild-type, srfA-null, and sigJ-null spores for:

      • Resistance to heat, desiccation, and detergents

      • Cell wall integrity using electron microscopy

      • Spore germination efficiency after stress exposure

  • Molecular Composition Analysis:

    • Analyze spore coat components in sigJ-null mutants

    • Examine potential changes in:

      • Cellulose content

      • Protein cross-linking

      • Glycoprotein composition

Research on srfA-null strains has shown that they form rounded spores that do not resist adverse environmental conditions . Ultrastructural analysis revealed that actin rods are initiated but do not elongate as in wild-type spores and subsequently disaggregate . The spore coats are initially indistinguishable from wild-type but become shredded with time . The specific contribution of sigJ to these phenotypes remains to be fully elucidated.

What is the role of sigJ in the response to environmental stressors?

While direct evidence for sigJ involvement in stress responses is limited, related research on D. discoideum's response to hyperosmotic stress provides a framework for investigation:

  • Stress Response Gene Expression:

    • Compare gene expression profiles between wild-type and sigJ-null cells under:

      • Hyperosmotic conditions (e.g., 200 mM sorbitol)

      • Oxidative stress

      • Nutrient deprivation

  • Cellular Adaptation Mechanisms:

    • Measure changes in:

      • Cell volume regulation

      • Cytoskeletal reorganization

      • Signaling pathway activation (e.g., STATc pathway)

Hyperosmotic stress in D. discoideum triggers dramatic transcriptional changes affecting more than 15% of the genes . The major responses include down-regulation of the metabolic machinery and up-regulation of the stress response system . Analyzing whether sigJ is part of this response network could provide insights into its function.

How does sigJ interact with other SrfA-regulated genes in developmental networks?

To understand the position of sigJ within the broader developmental regulatory network:

  • Comparative Transcriptomics:

    • Generate expression profiles for:

      • Wild-type cells

      • srfA-null cells

      • sigJ-null cells

      • Double or multiple mutants of SrfA-regulated genes

  • Temporal Sequence Analysis:

    • Determine the order of activation of SrfA-dependent genes

    • Establish potential regulatory hierarchies

Research has identified at least 21 genes whose expression is dependent on SrfA . The expression patterns of several SrfA-dependent genes (sigB, sigD, and 45D) show that they are expressed at late developmental stages (20-24h) in wild-type strains but show barely detectable expression in srfA-null strains .

Table: Temporal Expression Pattern of SrfA-dependent Genes

GeneVegetative CellsEarly DevelopmentLate Development (20-24h)Expression in srfA-null
sigBNot detectedNot detectedStrongBarely detectable
sigDNot detectedNot detectedStrongBarely detectable
45DNot detectedNot detectedStrongBarely detectable
sigALowDecreasedStrongly inducedModerately induced
sigCComplex pattern with two different RNAs
sigJNot detectedNot detectedStrongBarely detectable

How can transcriptional profiling data for sigJ be analyzed in the context of developmental gene networks?

For complex transcriptional data analysis:

  • Clustering Analysis:

    • Perform hierarchical clustering of gene expression data

    • Apply K-means or self-organizing map algorithms

    • Identify co-regulated gene clusters

  • Gene Ontology Enrichment:

    • Use tools like GOAT (Gene Ontology Analysis Tool)

    • Identify enriched biological process, molecular function, and cellular component GO terms

    • Focus on terms related to development and stress response

  • Network Analysis:

    • Construct gene regulatory networks based on expression correlations

    • Identify key nodes and regulatory motifs

    • Position sigJ within the broader developmental network

GOAT analysis of clusters containing up-regulated genes during development has revealed enrichment of genes involved in culmination during fruiting body formation and sporulation, consistent with the developmental timing of sigJ expression .

What bioinformatic approaches can identify potential functional domains in sigJ?

To predict functional elements:

  • Sequence-based Domain Prediction:

    • Apply tools such as SMART, Pfam, and InterProScan

    • Identify conserved domains and motifs

    • Predict transmembrane regions and signal peptides

  • Structural Prediction:

    • Use programs like AlphaFold or I-TASSER

    • Generate 3D structural models

    • Identify potential binding pockets or functional sites

  • Comparative Genomics:

    • Search for homologs in related species

    • Perform multiple sequence alignment

    • Identify evolutionarily conserved residues

The C-terminal region of sigJ contains a potential transmembrane domain, suggesting it may be membrane-associated. The protein also contains several lysine-rich regions that may be involved in protein-protein interactions .

How can contradictory findings about sigJ function be reconciled through experimental design?

When facing conflicting data:

  • Systematic Validation:

    • Verify conflicting results using multiple methodologies

    • Test under standardized conditions

    • Rule out strain-specific effects using isogenic backgrounds

  • Context-Dependent Function Analysis:

    • Investigate whether sigJ functions differ across:

      • Developmental stages

      • Environmental conditions

      • Genetic backgrounds

  • Technical Considerations:

    • Address potential methodological limitations:

      • RNA extraction methods (impact on transcript detection)

      • Protein expression systems (impact on folding/function)

      • Timing of observations during development

How can sigJ research contribute to understanding evolutionarily conserved developmental mechanisms?

While sigJ itself may not have direct homologs in higher organisms, the regulatory mechanisms controlling developmental gene expression show remarkable conservation:

  • Comparative Developmental Biology:

    • Identify functional analogs in other model systems

    • Compare developmental gene regulatory networks

    • Analyze conservation of transcription factor binding sites

  • Shared Cellular Processes:

    • Investigate whether sigJ participates in fundamental processes like:

      • Cell-cell communication

      • Differentiation pathways

      • Extracellular matrix formation

D. discoideum has proven valuable as a model for investigating many cellular processes including chemotaxis, cell motility, cell differentiation, and human disease pathogenesis . Unlike many single-cellular model systems, D. discoideum's genome encodes homologs of many genes implicated in human diseases, particularly neurodegenerative diseases .

What innovative experimental approaches could advance understanding of sigJ function?

To break new ground in sigJ research:

  • CRISPR-Cas9 Genome Editing:

    • Create precise mutations in functional domains

    • Generate fluorescently tagged endogenous sigJ

    • Develop conditional knockout systems

  • Single-Cell Analysis:

    • Apply single-cell RNA-seq to developing structures

    • Identify cell-type specific expression patterns

    • Map developmental trajectories at high resolution

  • Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics

    • Develop predictive models of sigJ function

    • Identify unexpected roles through unbiased approaches

How might sigJ research inform approaches to biotechnological applications using D. discoideum?

D. discoideum has potential as a biological production system:

  • Protein Expression Platform Development:

    • Optimize D. discoideum for recombinant protein production

    • Develop sigJ-based regulatory elements for controlled expression

    • Engineer cellular pathways to enhance protein secretion

  • Stress Response Applications:

    • Leverage knowledge of stress-responsive elements

    • Develop biosensors based on sigJ regulation

    • Engineer stress-resistant strains for biotechnological applications

D. discoideum has been shown to efficiently secrete recombinant proteins, with yields of up to 20mg/L for some proteins . Understanding sigJ and related regulatory mechanisms could further enhance the utility of D. discoideum as a eukaryotic expression system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.