Recombinant Dictyostelium discoideum Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (nsdhl)

Shipped with Ice Packs
In Stock

Description

Introduction

Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, commonly known as NSDHL, is an enzyme crucial in cholesterol biosynthesis . It catalyzes the NAD(P)+-dependent oxidative decarboxylation of C4 methyl groups of 4-alpha-carboxysterols during post-squalene cholesterol biosynthesis . The enzyme is located in the endoplasmic reticulum .

Gene and Protein Information

In humans, the NSDHL gene encodes sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating . This protein is essential for the sequential removal of two C-4 methyl groups in cholesterol biosynthesis after squalene production .

Function and Subcellular Localization

NSDHL functions as a sterol dehydrogenase or decarboxylase . Studies using confocal microscopy have revealed that NSDHL is localized in the endoplasmic reticulum (ER) and is also associated with lipid droplets . Furthermore, trafficking through the Golgi apparatus is necessary for the ER membrane localization of this protein . This dual localization may regulate intracellular cholesterol levels and accumulation sites .

Clinical Significance

Mutations in the NSDHL gene are linked to CHILD syndrome (congenital hemidysplasia with ichthyosiform nevus and limb defects), an X-linked dominant disorder affecting lipid metabolism and cholesterol biosynthesis . This condition is often lethal in males .

Role in Cholesterol Biosynthesis

NSDHL plays a vital role in cholesterol biosynthesis by catalyzing the removal of two C-4 methyl groups from sterols . This process is essential for producing cholesterol, a crucial component of cell membranes and a precursor for various steroid hormones .

Association with Lipid Droplets

A notable finding is the association of NSDHL with lipid droplets, which are cytoplasmic structures derived from the endoplasmic reticulum and contain a neutral lipid core . This association suggests that NSDHL may play a role in regulating cholesterol storage and mobilization within the cell .

Murine Studies

Studies involving murine models with mutations in the Nsdhl gene, such as bare patches and striated, have provided further insights into the function of NSDHL . These models help in understanding the impact of NSDHL mutations on development and cholesterol metabolism .

Localization and Trafficking

LocationSignificance
Endoplasmic ReticulumPrimary site for cholesterol biosynthesis enzymes; essential for NSDHL function .
Golgi ApparatusTrafficking through the Golgi is required for proper ER membrane localization of NSDHL .
Lipid DropletsAssociation suggests a role in regulating cholesterol storage and mobilization; provides a mechanism for controlling intracellular cholesterol levels .

Table of Related Disorders

DisorderGeneDescription
CHILD SyndromeNSDHLX-linked dominant disorder of lipid metabolism and cholesterol biosynthesis, often lethal in males .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for prioritized development.
Synonyms
nsdhl; DDB_G0286833; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
nsdhl
Target Protein Sequence
MKNVFLTGGSGFLGKYIIEELISNGYKVFALSRSETSNKVLSQMGATPVMSSLHDEQGLT EAIKGCDIVIHCAAKLETNSESVQELYKDNIDATELLFNICNQSSTSSVSVFCFISSEGV IMNGENINNATEDTPYPPIEQLGWYNKSKAISEQFLLATQSSMSRMKTIVIRLPLVWGSR DNVLDYLVGLCNKFQWFWIGGGKNYLSIVHAKNASYGIRLAIEKGDNQDIFHLTDGESVQ YRKFFTDRFKKKGVSTNKLHMVLPTPIALSLVWIMALIWKLFNLKGLPLLTKTGLIYSSK NFTINDDKARLKLGYTNKINYNQGMDEL
Uniprot No.

Target Background

Function
This recombinant Dictyostelium discoideum Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (nsdhl) catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols within the post-squalene cholesterol biosynthesis pathway.
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lipid droplet.

Q&A

What is NSDHL and what roles does it play in Dictyostelium discoideum?

NSDHL (NAD(P)H steroid dehydrogenase-like) is an enzyme involved in the post-squalene cholesterol biosynthesis pathway, specifically participating in the sequential removal of two C-4 methyl groups from sterol intermediates. In Dictyostelium discoideum, which has a remarkably expanded repertoire of genes involved in lipid metabolism comparable to higher eukaryotes, NSDHL functions as part of the 4-alpha-methylsterol-4-demethylase complex .

While Dictyostelium has been less studied than human NSDHL, the conservation of this enzyme across evolutionary distant organisms highlights its fundamental importance in sterol metabolism. Dictyostelium provides an excellent model system for studying NSDHL function due to its genetic tractability and the ability to observe phenotypic consequences across its unique developmental lifecycle .

How does the structure of Dictyostelium NSDHL compare to its human ortholog?

The human NSDHL protein consists of 373 amino acids with a molecular structure that has been recently characterized through crystallography . Dictyostelium NSDHL shares key conserved domains with its human counterpart, particularly in the catalytic region containing the Rossmann fold characteristic of NAD(P)-binding proteins.

Structural analysis of human NSDHL has revealed:

  • A coenzyme-binding site that undergoes conformational changes upon NAD+ binding

  • Key residues in the catalytic domain that are likely conserved in the Dictyostelium ortholog

  • A membrane-binding domain that facilitates association with the endoplasmic reticulum

Comparative structural alignment between human and Dictyostelium NSDHL would likely show conservation in these key functional domains, though specific differences in membrane association regions might exist due to the different lipid composition of Dictyostelium membranes .

What experimental advantages does Dictyostelium offer for studying NSDHL function?

Dictyostelium discoideum offers several significant advantages as a model organism for studying NSDHL function:

  • Genetic tractability: Recent advances allow efficient genetic manipulation including in non-axenic wild-type strains, permitting the introduction of specific mutations or gene knockouts .

  • Simplified developmental system: Dictyostelium's transition from unicellular to multicellular states provides a unique window to study NSDHL function during differentiation and development .

  • Conservation of key pathways: Despite its evolutionary distance from mammals, Dictyostelium remarkably preserves many key pathways relevant to human diseases, including components of cholesterol metabolism .

  • Single copy genes: Unlike many mammalian systems with redundant genes, Dictyostelium often contains single copies of genes, making it easier to study gene function without compensatory effects from paralogs .

  • Visualization of phenotypes: The organism's transparent nature facilitates microscopic observation of cellular processes and phenotypic outcomes .

This combination of features makes Dictyostelium particularly valuable for dissecting the mechanistic roles of NSDHL in lipid metabolism and cellular processes .

How do mutations in NSDHL affect sterol metabolism in model organisms?

Mutations in NSDHL have been extensively studied in various models, providing insights into its function and relationship to human diseases:

ModelMutation TypeMetabolic ConsequencesPhenotypic Outcomes
MouseLoss-of-function (Bpa, Str)Accumulation of 4α-methylsterolsEmbryonic lethality in males, skin and skeletal abnormalities in heterozygous females
HumanMissense (e.g., G44S, G205S)Defective 4α-demethylationCHILD syndrome with unilateral ichthyosiform erythroderma and limb defects
HumanFrameshift (e.g., c.131dupG)Complete loss of enzyme functionSevere CHILD syndrome manifestations including gastrointestinal involvement
Conditional knockout modelsTissue-specific deletionAltered cholesterol levels in specific tissuesDevelopmental defects depending on tissue affected

Sterol analysis from affected tissues in CHILD syndrome patients reveals increased levels of 4-alpha-methyl-5-alpha-cholest-8(9)-en-3ß-ol and 4-alpha-carboxy-4-methyl-cholest-8(9)-en-3beta-ol, indicating dysfunction of the 4-alpha-methylsterol-4-demethylase complex .

By extension, recombinant Dictyostelium NSDHL studies would likely focus on how introduced mutations affect sterol profiles and whether these mirror the accumulation patterns seen in mammalian models. Dictyostelium's simplified genome and development cycle could provide clearer insights into the primary effects of these mutations without confounding secondary effects .

What methodological approaches are most effective for purifying active recombinant Dictyostelium NSDHL?

Based on successful approaches with human NSDHL , the following methodology would likely be effective for Dictyostelium NSDHL:

  • Expression system selection:

    • Bacterial expression (E. coli) with N-terminal His-tag fusion for soluble domains

    • Wheat germ cell-free expression systems for full-length protein (as demonstrated with human NSDHL)

    • Dictyostelium expression system for native post-translational modifications

  • Purification protocol:

    • Initial capture using nickel affinity chromatography

    • Buffer optimization containing 10-20% glycerol to maintain stability

    • Size exclusion chromatography for final purification and oligomeric state determination

    • Consider detergent inclusion (e.g., 0.03% DDM) if membrane domains are included

  • Activity preservation:

    • Addition of NAD+ or NADH (1 mM) to stabilize the enzyme

    • Storage buffer containing 50 mM HEPES (pH 8.0), 500 mM NaCl and 20% glycerol

  • Quality assessment:

    • Thermal shift assays to assess protein stability (Tm determination)

    • SEC-MALS analysis to confirm oligomeric state

    • Activity assays measuring dehydrogenase function with appropriate sterol substrates

The challenge with Dictyostelium NSDHL would likely be maintaining the native membrane association characteristics while preserving enzymatic activity .

How can NSDHL inhibition be assessed and what are its consequences in Dictyostelium?

Assessment of NSDHL inhibition in Dictyostelium would involve:

  • Direct enzyme inhibition assays:

    • Fluorescence-based assays monitoring NADH consumption/production

    • Competitive binding assays with labeled NAD+ or substrate analogs

    • Structure-based virtual screening to identify potential inhibitors, as performed for human NSDHL

  • Cellular assays in Dictyostelium:

    • Sterol profiling using GC-MS to detect accumulation of 4α-methyl sterols

    • Growth rate measurements in the presence of inhibitors

    • Developmental assays to assess effects on multicellular morphogenesis

    • Live cell imaging to monitor lipid droplet formation and dynamics

  • Genetic approaches:

    • CRISPR-Cas9-mediated conditional knockdown

    • Temperature-sensitive mutants for temporal control of NSDHL function

    • Rescue experiments with inhibitor-resistant NSDHL variants

The consequences of NSDHL inhibition in Dictyostelium would likely include:

  • Altered sterol profile with accumulation of methylated intermediates

  • Disrupted lipid droplet formation and dynamics

  • Defects in membrane organization affecting signaling pathways

  • Potential developmental abnormalities during multicellular stages

  • Altered resistance to environmental stressors

Studies in human cancer models suggest NSDHL inhibition may affect growth factor receptor trafficking, which could have parallel effects on Dictyostelium receptor functions important for chemotaxis and development .

What is the relationship between NSDHL and extracellular vesicle (EV) production in Dictyostelium?

Recent research has identified Dictyostelium discoideum as an emerging model for studying extracellular vesicles (EVs), which are important messengers for intercellular communication . While direct evidence linking NSDHL specifically to EV production in Dictyostelium is limited, there are several hypothetical connections worth investigating:

  • Lipid composition: NSDHL's role in sterol metabolism likely influences membrane lipid composition, which is critical for EV biogenesis. Alterations in sterol content could affect membrane curvature and the sorting of cargo into EVs.

  • Lipid raft involvement: NSDHL associates with lipid droplets and the endoplasmic reticulum , and these associations might influence lipid raft formation, which are important for EV budding.

  • Developmental signaling: During Dictyostelium's multicellular development, intercellular communication is essential, and EVs might serve as one mechanism. NSDHL's differential expression during development could regulate EV production at specific developmental stages.

  • Stress response: Under starvation or other stresses, Dictyostelium alters its metabolism and communication patterns. NSDHL activity might be modulated during stress, affecting EV cargo or production rates.

Methodological approaches to study this relationship could include:

  • Comparing EV production in NSDHL-depleted versus wild-type cells

  • Lipidomic analysis of EVs from cells with altered NSDHL activity

  • Live imaging of fluorescently tagged NSDHL during EV biogenesis

  • Analysis of EV-mediated signaling in NSDHL mutant backgrounds

What genetic engineering approaches are most effective for studying NSDHL in Dictyostelium?

Recent advances in Dictyostelium genetic manipulation have significantly expanded the available toolkit for studying genes like NSDHL:

  • CRISPR-Cas9 genome editing:

    • Allows precise introduction of point mutations matching human disease variants

    • Can generate complete knockouts to assess essentiality

    • Enables tagging of endogenous NSDHL with fluorescent proteins or affinity tags

    • Works efficiently in both axenic and non-axenic strains using optimized protocols

  • Inducible expression systems:

    • Tetracycline-regulated promoters for temporal control

    • Developmental stage-specific promoters for spatial-temporal regulation

    • Heat-shock inducible systems for acute expression changes

  • Knockout and rescue strategies:

    • Generation of NSDHL knockout strains complemented with wild-type or mutant variants

    • Introduction of human NSDHL to assess functional conservation

    • Creation of chimeric proteins to identify key functional domains

  • Single-cell approaches:

    • CRISPR interference (CRISPRi) for partial knockdown

    • Single cell transcriptomics to assess effects on gene expression networks

    • Mosaic analysis for studying cell-autonomous versus non-autonomous effects

Implementation considerations include using the simplified transfection protocol developed for non-axenic wild-type cells, which overcomes limitations of previous methods that were optimized only for axenic laboratory strains . This approach allows for the generation of recombinant cells in days rather than weeks and enables genetic manipulation of freshly isolated wild-type Dictyostelium samples from the environment .

What analytical methods are most appropriate for characterizing the enzymatic activity of recombinant Dictyostelium NSDHL?

Comprehensive characterization of recombinant Dictyostelium NSDHL enzymatic activity requires multiple complementary approaches:

  • Spectrophotometric assays:

    • Continuous monitoring of NAD+/NADH conversion at 340 nm

    • Determination of kinetic parameters (Km, Vmax, kcat) for various substrates

    • Inhibition studies with competitive and non-competitive inhibitors

  • Sterol analysis:

    • Gas chromatography-mass spectrometry (GC-MS) to identify and quantify sterol intermediates

    • Liquid chromatography-mass spectrometry (LC-MS) for more comprehensive sterol profiling

    • Isotope labeling to track sterol conversion rates and pathways

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to determine binding constants for NAD+, NADH, NADP+, and NADPH

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Thermal shift assays to assess protein stability upon ligand binding

  • Structural characterization:

    • X-ray crystallography of the enzyme with and without bound cofactors/substrates

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism

Based on studies with human NSDHL, a methodological approach using ITC has been successful in determining the binding thermodynamics of various cofactors. For example, human NSDHL shows stronger binding to NADH (Kd = 0.98 ± 0.06 μM) compared to NAD+ (Kd = 80.3 ± 7.3 μM) , and similar comparative studies would be valuable for the Dictyostelium enzyme.

How can structural information about NSDHL inform the development of specific inhibitors?

Structural information about NSDHL can guide inhibitor development through multiple strategic approaches:

  • Structure-based virtual screening:

    • The crystal structures of human NSDHL reveal a detailed description of the coenzyme-binding site and conformational changes upon NAD+ binding

    • Virtual screening of compound libraries against these sites identified novel inhibitors with selective activity

    • Similar approaches could be applied to Dictyostelium NSDHL once structural data is available

  • Key structural insights:

    • The NAD+-binding pocket shows distinct conformations in apo- and holo-forms

    • Specific residues in the active site that interact with the coenzyme can be targeted

    • Unique features of the substrate-binding site can be exploited for selectivity

  • Rational design strategy:

    • Design compounds that mimic the transition state of the enzymatic reaction

    • Target allosteric sites identified from structural analysis

    • Develop covalent inhibitors targeting catalytic residues

  • Structure-activity relationship studies:

    • Systematic modification of lead compounds based on structural information

    • Correlation of inhibitory potency with specific structural features

    • Optimization of pharmacokinetic properties while maintaining target engagement

Successful application of this approach for human NSDHL led to the identification of inhibitors that not only affected cholesterol metabolism but also suppressed EGFR signaling in cancer cells, enhancing the effects of EGFR kinase inhibitors . Similar structure-based approaches could yield Dictyostelium-specific inhibitors for research purposes or potentially identify new scaffolds for therapeutic development .

What experimental designs best evaluate the developmental consequences of NSDHL dysfunction in Dictyostelium?

Dictyostelium's unique developmental lifecycle provides exceptional opportunities to study the consequences of NSDHL dysfunction:

  • Developmental time course analysis:

    • Synchronous starvation-induced development on non-nutrient agar

    • Time-lapse imaging to track morphological progression through developmental stages

    • Quantification of timing, efficiency, and structural abnormalities in fruiting body formation

    • Comparison of wild-type, knockout, and complemented strains

  • Cell-type specific effects:

    • Cell-type specific markers to assess proportions of stalk versus spore cells

    • Chimeric development with labeled NSDHL-deficient cells mixed with wild-type cells

    • In situ hybridization to track expression patterns during development

    • Cell sorting to analyze differential effects on pre-stalk versus pre-spore populations

  • Molecular and cellular analyses:

    • Lipid profiling at different developmental stages

    • Transcriptomics to identify affected signaling pathways

    • Phosphoproteomics to detect changes in signaling cascades

    • Analysis of autophagy, which is critical for Dictyostelium development

  • Stress response evaluation:

    • Response to DNA damaging agents during development (relevant as Dictyostelium shows remarkable DNA repair capabilities)

    • Germination efficiency of spores from NSDHL-deficient strains

    • Survival under various environmental stressors

This multifaceted approach would provide comprehensive insights into how NSDHL function affects development at cellular, molecular, and organismal levels, potentially revealing novel aspects of sterol metabolism in morphogenesis and differentiation .

How can insights from Dictyostelium NSDHL studies inform our understanding of human CHILD syndrome?

Dictyostelium studies offer unique perspectives on CHILD syndrome pathophysiology:

  • Genotype-phenotype correlations:

    • Introduction of human CHILD syndrome mutations (e.g., G44S, G205S, frameshifts) into Dictyostelium NSDHL

    • Assessment of enzymatic activity, protein stability, and cellular localization of mutant proteins

    • Correlation of biochemical defects with developmental consequences

  • Sterol metabolism insights:

    • Detailed characterization of sterol profiles in mutants using mass spectrometry

    • Identification of potentially toxic intermediates that accumulate in specific tissues

    • Testing whether supplementation with downstream metabolites can rescue phenotypes

  • Pathway interactions:

    • Exploration of interactions between NSDHL and other cellular pathways

    • Investigation of compensatory mechanisms that might explain tissue-specific manifestations

    • Analysis of hedgehog signaling, which is affected in CHILD syndrome and present in Dictyostelium

  • Therapeutic development:

    • Testing of combination treatments (e.g., statins with cholesterol, as used successfully in CHILD syndrome)

    • Screening for compounds that might bypass the metabolic block or reduce toxic intermediate accumulation

    • Evaluation of compounds that modulate autophagy, which might clear accumulated sterols

Dictyostelium's developmental system could be particularly valuable for understanding why CHILD syndrome manifests unilaterally and affects specific tissues, potentially providing insights into the spatial regulation of sterol metabolism during development .

What role might NSDHL play in cancer biology and how can Dictyostelium models contribute to this understanding?

Recent research has unveiled connections between NSDHL and cancer biology that could be further explored using Dictyostelium:

  • NSDHL in breast cancer stem-like cells:

    • NSDHL knockdown suppresses tumor spheroid formation in MCF-7 human breast cancer cells

    • RNA sequencing reveals NSDHL knockdown induces widespread transcriptional changes

    • TGF-β signaling pathway is significantly affected by NSDHL depletion

    • Orthotopic tumor models show reduced tumor initiation and growth with NSDHL knockdown

  • EGFR trafficking regulation:

    • NSDHL functions as a regulator of EGFR trafficking pathways

    • Inhibition of NSDHL enhances the antitumor effect of EGFR kinase inhibitors in EGFR-driven cancer cells

  • Potential Dictyostelium contributions:

    • Detailed characterization of membrane receptor trafficking in NSDHL-deficient Dictyostelium

    • Analysis of TGF-β-like signaling pathways in Dictyostelium with altered NSDHL function

    • Study of cell motility and chemotaxis, processes relevant to cancer metastasis

    • Investigation of autophagy regulation, which is important in both cancer and Dictyostelium development

  • Methodological approaches:

    • Gene expression profiling in NSDHL-deficient Dictyostelium during development

    • Chemotaxis assays in the presence of NSDHL inhibitors

    • Analysis of extracellular vesicle production and content with altered NSDHL activity

    • Screening for synthetic lethal interactions with NSDHL depletion

The simplified genetic background of Dictyostelium could help identify core cellular processes affected by NSDHL dysfunction that contribute to cancer biology, potentially revealing new therapeutic targets or strategies .

What emerging technologies could advance our understanding of Dictyostelium NSDHL function?

Several cutting-edge technologies hold promise for deeper insights into NSDHL biology:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of NSDHL structure in membrane-associated contexts

    • Visualization of NSDHL within larger complexes on lipid droplets or ER membranes

    • Structural characterization of conformational changes during catalysis

  • Genome-wide CRISPR screens:

    • Identification of synthetic lethal interactions with NSDHL

    • Discovery of compensatory pathways when NSDHL function is compromised

    • Mapping of genetic interactions in different developmental contexts

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize NSDHL dynamics in living cells

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Live multi-color imaging to track NSDHL interactions with other proteins

  • Single-cell multi-omics:

    • Combined transcriptomic, proteomic, and metabolomic analysis of NSDHL-deficient cells

    • Spatial transcriptomics to map expression patterns during development

    • Single-cell metabolomics to detect cell-to-cell variability in sterol profiles

  • In situ structural biology:

    • FRET sensors to monitor NSDHL activity in living cells

    • Optogenetic control of NSDHL function with spatial and temporal precision

    • Proximity labeling to identify interaction partners in different cellular contexts

These technologies could provide unprecedented insights into the dynamic role of NSDHL in lipid metabolism, membrane organization, and developmental processes in Dictyostelium .

How might comparative studies between human and Dictyostelium NSDHL inform evolutionary aspects of sterol metabolism?

Comparative studies between human and Dictyostelium NSDHL offer valuable evolutionary insights:

  • Functional conservation analysis:

    • Cross-species complementation experiments to test functional equivalence

    • Identification of core conserved domains versus lineage-specific adaptations

    • Comparison of substrate specificities and catalytic efficiencies

  • Structural evolution:

    • Comparative structural analysis of NSDHL orthologs across diverse eukaryotes

    • Identification of conserved active site architecture versus divergent regulatory domains

    • Analysis of adaptive changes related to membrane association in different organisms

  • Pathway integration:

    • Comparison of how NSDHL is integrated into sterol biosynthesis pathways across species

    • Analysis of regulatory mechanisms controlling NSDHL expression and activity

    • Investigation of how NSDHL function coordinates with other metabolic pathways

  • Environmental adaptations:

    • Study of how NSDHL function may have adapted to different ecological niches

    • Analysis of stress response pathways involving NSDHL across species

    • Investigation of how sterol metabolism contributes to environmental resilience

These comparative approaches could reveal fundamental principles of sterol metabolism evolution and potentially identify novel regulatory mechanisms that have been conserved from single-celled eukaryotes to humans .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.