Recombinant Dictyostelium discoideum Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (sdhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sdhC; DDB_G0275115; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-192
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
TLTSKNIYLSQTNTTNTPLSYSTQAKKPFTITEKRIDELKTPYQPTSPHLTIYKFPLPAV MSIMHRATGICLALGITGLAGVTLFAPHDAIHYIQLLHTQYPALVYPAKFAVALPLTYHF CTGVRHIIWDETVKGLSISQIESSGKVLLAVVAVLSTIFTFVSFK
Uniprot No.

Target Background

Function

This protein is the membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of complex II in the mitochondrial electron transport chain. Its function is to facilitate electron transfer from succinate to ubiquinone (coenzyme Q).

Database Links
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of SdhC in Dictyostelium discoideum mitochondria?

SdhC functions as the cytochrome b560 subunit of Complex II (succinate dehydrogenase) in the mitochondrial respiratory chain of D. discoideum. This complex is essential for the tricarboxylic acid (TCA) cycle and electron transport chain, catalyzing the oxidation of succinate to fumarate while reducing ubiquinone to ubiquinol. SdhC specifically serves as a membrane anchor for the complex and contains a heme group (cytochrome b560), which is involved in electron transfer processes.

As demonstrated in knockdown studies, SdhC is necessary for proper succinate dehydrogenase activity. When SdhC expression is reduced through antisense inhibition, there is a corresponding decrease in the succinate dehydrogenase activity, confirming its essential role in the functional complex . This reduction can be measured through standard succinate dehydrogenase activity assays following the reduction of DCPIP (2,6-Dichlorophenolindophenol sodium salt hydrate) at 600 nm.

How is SdhC structurally organized in the mitochondrial genome of D. discoideum?

The SdhC gene in D. discoideum encodes the cytochrome b560 subunit of respiratory complex II. While specific details about the genomic organization of SdhC in D. discoideum are not fully detailed in the provided search results, we can infer information based on related research.

The mitochondrial DNA of D. discoideum contains genes for components of the respiratory chain complexes, including those related to cytochrome oxidase genes . Unlike some other protists that may have fragmented or rearranged mitochondrial genomes, D. discoideum maintains a relatively conventional organization of its mitochondrial genes. The genomic context of SdhC would be important for understanding its regulation and expression patterns, particularly when designing targeting constructs for genetic manipulation experiments.

What are the common methods for generating recombinant SdhC from D. discoideum?

Recombinant production of SdhC from D. discoideum typically follows standard recombinant protein expression strategies, with specific modifications to address the challenges of membrane protein expression. Based on the search results and general recombinant protein methodologies, the following approaches are commonly employed:

  • Expression vector construction: The SdhC gene is isolated from D. discoideum genomic DNA or cDNA and cloned into an appropriate expression vector with regulatory elements suitable for the chosen host system .

  • Host selection: While E. coli is often the first choice for recombinant protein expression, membrane proteins like SdhC may benefit from expression in eukaryotic systems that provide appropriate post-translational modifications and membrane insertion machinery. Options include yeast, insect cells, or mammalian cells .

  • Optimization of expression conditions: Design of Experiments (DoE) approaches are particularly valuable for optimizing SdhC expression, as they efficiently identify optimal conditions through a systematic testing of multiple factors simultaneously . This might include varying parameters such as:

    • Induction timing and concentration

    • Growth temperature

    • Media composition

    • Codon optimization strategies

  • Accessibility enhancement: For improving expression efficiency, attention to the translation initiation site accessibility is critical. Modifying up to the first nine codons with synonymous substitutions can significantly improve expression success rates without altering the protein sequence .

How does knockdown of SdhC affect mitochondrial function compared to other Sdh subunits in D. discoideum?

Knockdown studies of different Sdh subunits in D. discoideum reveal distinct cytopathological consequences, suggesting specialized roles beyond their contributions to complex II activity. When examining SdhC knockdown specifically:

  • Respiratory impacts: SdhC knockdown results in reductions in the mitochondrial components of basal respiration, particularly in the proton leak (statistically significant). Additionally, mitochondrial components of maximum respiratory capacity show reduction, significantly in complex II activity. Interestingly, this is accompanied by elevated rates of nonmitochondrial O₂ consumption, suggesting metabolic dysregulation distinct from SdhA knockdown effects .

  • Growth phenotype: Unlike SdhA knockdown, SdhC knockdown leads to defects in growth on bacterial lawns without corresponding impairment of phagocytosis. This suggests a specific metabolic defect rather than a general energy shortage .

  • ATP production: Notably, SdhC knockdown does not impair mitochondrial biogenesis, ATP synthesis rates, or ATP steady state levels, contrasting with the effects seen in SdhA knockdown .

The table below summarizes the comparative effects of knocking down different Sdh subunits in D. discoideum:

ParameterSdhA KnockdownSdhC KnockdownSdhB Knockdown
Sdh ActivitySignificant decreaseSignificant decreaseNon-significant decrease
Growth on BacteriaImpairedDefectiveDefective
PhagocytosisImpairedNormalNormal
Mitochondrial BiogenesisAffectedNot impairedNot impaired
ATP Levels/SynthesisReducedNormalNormal
Basal RespirationDecreasedDecreased (proton leak)Increased
Max Respiratory CapacityDecreasedDecreased (Complex II)Increased
Non-mitochondrial O₂ ConsumptionNormalElevatedNormal

These differential outcomes suggest that while all three subunits contribute to Sdh activity, they may have additional independent functions or affect cellular metabolism through distinct mechanisms .

What are the methodological challenges in assessing SdhC function through knockdown experiments?

Investigating SdhC function through knockdown approaches presents several methodological challenges that researchers must address:

  • Effective knockdown verification: Unlike some proteins that can be easily quantified by western blotting, membrane proteins like SdhC may require specialized antibodies or techniques. Researchers must validate knockdown efficiency through multiple approaches such as:

    • Western blotting with appropriate detergent extraction methods for membrane proteins

    • qRT-PCR for mRNA level assessment

    • Functional assays such as succinate dehydrogenase activity

  • Enzyme activity assessment: The succinate dehydrogenase activity assay requires careful standardization. As described in the methodology from the cited research, this involves:

    • Precise cell preparation (1 × 10⁶/mL)

    • Controlled lysis by freezing at -80°C

    • Specific assay buffer composition (10 mM KH₂PO₄, 2 mM EDTA, 1 mg/mL BSA, 80 μM DCPIP, 4 μM rotenone, 0.2 mM ATP, 10 mM succinate)

    • Monitoring DCPIP reduction at 600 nm

    • Proper controls including complete inhibition with malonate

  • Respiration measurements interpretation: Changes in respiratory parameters may reflect complex compensatory mechanisms rather than direct effects of SdhC reduction. Researchers must carefully interpret:

    • Basal respiration changes

    • Maximum respiratory capacity

    • Non-mitochondrial oxygen consumption

    • Proton leak components

  • Phenotypic analysis complexity: Growth defects on bacterial lawns without phagocytosis impairment suggest specific metabolic adaptations that require multiple experimental approaches to fully characterize .

  • Statistical power: Achieving statistical significance can be challenging, especially when the biological effects are subtle or variable. This requires careful experimental design with sufficient replicates and appropriate statistical analyses .

How can researchers optimize recombinant SdhC expression using Design of Experiments (DoE) approaches?

Recombinant SdhC expression optimization can be significantly enhanced through Design of Experiments (DoE) methodologies, which provide systematic frameworks for identifying optimal conditions with fewer experiments than traditional one-factor-at-a-time approaches.

For SdhC expression, researchers should consider implementing the following DoE strategy:

  • Factor identification: Identify key factors affecting SdhC expression, potentially including:

    • Expression host (bacterial, yeast, insect, or mammalian systems)

    • Media composition (carbon source, nitrogen source, salt concentration)

    • Induction parameters (inducer concentration, induction timing)

    • Growth conditions (temperature, pH, oxygen levels)

    • Vector design elements (promoter strength, ribosome binding site optimization)

  • Experimental design selection: Choose an appropriate DoE approach based on the number of factors:

    • Factorial designs for screening many factors with fewer experiments

    • Response surface methodology (RSM) for detailed optimization of critical factors

    • Central composite designs for modeling quadratic effects and identifying optimal points

  • mRNA structure optimization: Given the importance of translation initiation site accessibility for successful recombinant protein expression, incorporate mRNA folding parameters:

    • Apply accessibility modeling using Boltzmann's ensemble calculations

    • Consider synonymous codon substitutions in the first nine codons to optimize mRNA accessibility

    • Use tools like TIsigner that employ simulated annealing to identify optimal codon arrangements

  • Quantitative response measurement: Establish reliable quantification methods for SdhC expression:

    • Western blotting with appropriate membrane protein extraction protocols

    • Functional activity assays for properly folded protein

    • Fluorescent tagging approaches if structural integrity is maintained

  • Statistical analysis: Apply appropriate statistical tools to:

    • Identify significant factors affecting expression

    • Model interactions between factors

    • Predict optimal conditions

    • Validate model predictions with confirmation experiments

The accessibility of translation initiation sites has been shown to outperform alternative features in predicting expression success, with a study of 11,430 recombinant proteins showing that this approach accurately predicts expression outcomes in E. coli . For SdhC specifically, optimization of mRNA accessibility through synonymous substitutions could potentially increase expression yields by several fold while maintaining the native protein sequence.

What are the most effective protocols for measuring succinate dehydrogenase activity in recombinant SdhC-expressing systems?

Accurate measurement of succinate dehydrogenase activity is critical for assessing the functionality of recombinant SdhC. Based on established protocols, the following methodology provides reliable quantification:

Standard Spectrophotometric Assay Protocol:

  • Cell preparation:

    • Harvest exponentially growing cells

    • Wash and resuspend in H₂O to a density of 1 × 10⁶ cells/mL

    • Lyse cells by quick freezing at -80°C for 15-30 min

  • Reaction setup:

    • In a clear 96-well flat-bottom plate, add 40 μL of succinate reductase assay buffer containing:

      • 10 mM KH₂PO₄

      • 2 mM EDTA

      • 1 mg/mL BSA

      • 80 μM DCPIP (2,6-Dichlorophenolindophenol sodium salt hydrate)

      • 4 μM rotenone (Complex I inhibitor)

      • 0.2 mM ATP

      • 10 mM succinate

    • Add 50 μL of cell lysate

  • Reaction initiation and measurement:

    • Start the reaction by injecting 10 μL of 80 μM decylubiquinone

    • Measure absorbance at 600 nm for 10-15 min using a microplate reader

    • For complete inhibition control, inject 10 mM malonate (competitive inhibitor of succinate dehydrogenase)

  • Calculation:

    • Calculate the rate of DCPIP reduction by measuring the decrease in absorbance at 600 nm over time

    • Subtract background rates obtained with malonate inhibition

    • Convert to enzyme activity using the extinction coefficient of DCPIP (ε = 21,000 M⁻¹cm⁻¹ at pH 7.0)

    • Express activity as nmol DCPIP reduced/min/mg protein

Alternative/Complementary Approaches:

  • Oxygen consumption measurement:

    • Use oxygen electrodes or plate-based respirometry (e.g., Seahorse XF Analyzer)

    • Measure succinate-driven oxygen consumption in presence of specific inhibitors

    • Quantify the malonate-sensitive component of respiration

  • Fumarate production assay:

    • Quantify the formation of fumarate using HPLC or coupled enzymatic assays

    • This measures the forward reaction of succinate dehydrogenase

How can researchers effectively design antisense inhibition constructs for SdhC expression studies?

Designing effective antisense inhibition constructs for SdhC expression studies requires careful consideration of multiple factors to ensure specific and efficient knockdown. Based on successful approaches in D. discoideum and general antisense strategies, the following protocol is recommended:

  • Target sequence selection:

    • Identify unique regions within the SdhC coding sequence with minimal homology to other genes

    • Focus on regions near the 5' end of the mRNA for maximum translation disruption

    • Avoid sequences with potential secondary structures that might impede antisense binding

    • Optimal antisense length is typically 300-500 nucleotides for stable construct expression

  • Vector design:

    • Use an expression vector with a strong, constitutive promoter (e.g., actin15 promoter for D. discoideum)

    • Include a selectable marker appropriate for your experimental system (e.g., G418 resistance)

    • Orient the target sequence in the antisense direction relative to the promoter

    • Consider including a reporter gene (e.g., GFP) on the same transcript but with an IRES element to monitor expression

  • Transformation protocol for D. discoideum:

    • Transform parental strain (e.g., AX2) using established electroporation protocols

    • Select transformants with appropriate antibiotics

    • Isolate multiple independent clones for analysis to account for position effects

  • Verification of knockdown efficiency:

    • Quantitative RT-PCR to measure target mRNA levels using gene-specific primers that amplify a ~100 bp region (as used for SdhB verification)

    • Western blotting using antibodies specific to SdhC protein

    • Functional assays such as succinate dehydrogenase activity measurement

  • Controls:

    • Empty vector transformants to control for vector effects

    • Antisense constructs targeting non-related genes to control for non-specific effects

    • Wild-type cells as baseline controls

The effectiveness of antisense inhibition in D. discoideum has been demonstrated in studies targeting various Sdh subunits, resulting in reduced protein expression and corresponding decreases in enzyme activity. The antisense approach provides the advantage of creating stable knockdown strains with partial reduction of expression rather than complete knockouts, allowing the study of genes that might be essential for viability when completely eliminated .

What approaches can be used to analyze the effects of SdhC expression on mitochondrial respiration?

Analysis of mitochondrial respiration in the context of SdhC expression requires comprehensive assessment of respiratory chain function. The following methodological approaches provide detailed insights into how SdhC expression affects mitochondrial energy metabolism:

From studies in D. discoideum, SdhC knockdown resulted in specific alterations to respiration, including:

  • Reduced mitochondrial components of basal respiration (particularly proton leak)

  • Decreased mitochondrial components of maximum respiratory capacity

  • Specifically reduced Complex II activity

  • Elevated non-mitochondrial oxygen consumption

These findings suggest that beyond its role in Complex II, SdhC may influence broader aspects of cellular metabolism and oxygen utilization pathways. The specific respiratory phenotype of SdhC knockdown differs from that of other Sdh subunits, highlighting the unique contribution of each subunit to mitochondrial function .

How do the effects of SdhC knockdown in D. discoideum compare to knockdown of other Sdh subunits?

Comparative analysis of Sdh subunit knockdowns in D. discoideum reveals distinct cytopathological profiles, suggesting subunit-specific roles beyond their common function in Complex II:

  • Enzymatic activity impacts:
    All three subunits (SdhA, SdhB, SdhC) contribute to succinate dehydrogenase activity, but with varying degrees of impact when knocked down:

    • SdhA knockdown: Significant decrease in enzyme activity

    • SdhC knockdown: Significant decrease in enzyme activity

    • SdhB knockdown: Decreased activity but not reaching statistical significance

  • Growth and phagocytosis phenotypes:

    • SdhA knockdown: Impaired growth on bacterial lawns with corresponding impairment of phagocytosis

    • SdhB/SdhC knockdowns: Defective growth on bacterial lawns but with normal phagocytosis, suggesting a metabolic defect distinct from that caused by SdhA reduction

  • Mitochondrial biogenesis and ATP production:

    • SdhA knockdown: Impaired mitochondrial biogenesis and reduced ATP levels

    • SdhB/SdhC knockdowns: No impairment of mitochondrial biogenesis, ATP synthesis rates, or ATP steady state levels

  • Respiratory chain function:
    The most striking differences appear in respiratory chain function:

    • SdhA knockdown: General decrease in respiratory parameters

    • SdhC knockdown: Reduced mitochondrial components of respiration (particularly proton leak and Complex II activity) with elevated non-mitochondrial oxygen consumption

    • SdhB knockdown: Surprisingly increased respiratory function, including elevated basal respiration, maximum respiratory capacity, and Complex I activity

These distinct profiles suggest that while the Sdh subunits function together in Complex II, they may have additional roles or influence different compensatory pathways when their expression is reduced. The SdhC-specific pattern of respiratory alterations, particularly the combination of reduced Complex II activity with elevated non-mitochondrial oxygen consumption, points to a unique role in coordinating mitochondrial and non-mitochondrial metabolism .

What insights can D. discoideum SdhC studies provide for understanding human mitochondrial disorders?

D. discoideum as a model organism offers valuable insights into human mitochondrial disorders, particularly those involving succinate dehydrogenase dysfunction:

  • Conservation of Complex II structure and function:
    The fundamental structure of succinate dehydrogenase is evolutionarily conserved from D. discoideum to humans, making findings in this model organism potentially translatable to human disease mechanisms. Both organisms have four-subunit complexes with similar catalytic functions .

  • Differential pathology of subunit dysfunction:
    In humans, mutations in different Sdh subunits produce distinct clinical outcomes:

    • SdhA mutations primarily cause typical mitochondrial disease phenotypes (neurodegeneration, myopathies)

    • Mutations in other subunits (including SdhC) more frequently cause cancer phenotypes

    These differential outcomes parallel the distinct phenotypic profiles observed when different subunits are knocked down in D. discoideum, suggesting conserved subunit-specific functions .

  • Metabolic compensation mechanisms:
    The SdhC knockdown in D. discoideum reveals specific compensatory changes, particularly increased non-mitochondrial oxygen consumption. This suggests mechanisms through which cells adapt to partial Complex II dysfunction, potentially informing therapeutic approaches for mitochondrial disorders .

  • Energy sensing and signaling pathways:
    In D. discoideum, SdhA knockdown activated AMPK-mediated responses typical of energy deficiency, while SdhC knockdown did not. This differential signaling response may help explain why mutations in different Complex II subunits lead to distinct clinical presentations in humans .

  • Alternative complex assembly:
    Recent research has suggested that when SdhB expression is reduced, an alternative assembly of Complex II termed "CII low" can form, where SdhA associates with accessory proteins without other subunits. Similar alternative assemblies might occur with SdhC reduction, potentially explaining some of the unique phenotypic outcomes .

The D. discoideum model thus provides a valuable experimental system to investigate the fundamental mechanisms underlying subunit-specific pathologies in human Complex II disorders, potentially leading to more targeted therapeutic strategies for conditions associated with SdhC dysfunction .

What technical considerations are most important when comparing different expression systems for recombinant SdhC production?

When selecting an expression system for recombinant SdhC production, researchers must evaluate several technical aspects that significantly impact success:

  • Membrane protein expression challenges:
    SdhC is a membrane-embedded subunit of Complex II, presenting specific challenges:

    • Proper membrane insertion machinery requirements

    • Potential toxicity to host cells when overexpressed

    • Need for specific detergents for extraction and purification

    • Proper folding in membrane environment

  • Expression host comparison:
    Different expression systems offer distinct advantages:

    Host SystemAdvantagesDisadvantagesConsiderations for SdhC
    E. coliHigh yield, simple, cost-effectiveLimited post-translational modifications, inclusion body formationMay require fusion partners, specialized strains, lower temperature
    YeastEukaryotic processing, high density culturesHyperglycosylation, different membrane compositionGood balance of yield and proper folding
    Insect cellsNear-native folding, high expressionMore expensive, longer processExcellent for functional studies requiring proper assembly
    Mammalian cellsNative-like processing and foldingHighest cost, lower yieldsBest for structural studies requiring native conformation
  • Translation initiation optimization:
    Accessibility of translation initiation sites is crucial for successful expression:

    • mRNA secondary structure around start codon significantly impacts expression

    • Modifying up to the first nine codons with synonymous substitutions can dramatically improve expression

    • Accessibility modeling using Boltzmann's ensemble calculations provides predictive power for expression success

  • Codon optimization strategies:
    While traditional codon optimization focuses on frequency, context-dependent optimization is superior:

    • Consider mRNA structure impact rather than just codon usage frequency

    • Focus on accessibility of translation initiation region

    • Synonymous substitutions should be designed to minimize stable secondary structures

  • Experimental design approach:
    Design of Experiments (DoE) methodology provides efficient optimization:

    • Test multiple variables simultaneously rather than one-at-a-time

    • Identify interaction effects between factors (e.g., temperature and inducer concentration)

    • Develop predictive models for optimal conditions

    • Reduce experimental cost and time through efficient experimental designs

For SdhC specifically, a successful expression strategy might involve:

  • Initial screening of multiple expression systems using DoE approaches

  • Optimization of translation initiation region accessibility through synonymous codon substitutions

  • Fine-tuning of expression conditions based on statistical models

  • Validation of proper folding and function through activity assays

How can recombinant SdhC be used to investigate Complex II assembly and function?

Recombinant SdhC provides a powerful tool for investigating Complex II assembly and function through several experimental approaches:

The antisense inhibition studies in D. discoideum have already revealed unique respiratory and growth phenotypes associated with SdhC reduction, suggesting functions beyond its canonical role in Complex II . Recombinant SdhC provides a complementary approach to further dissect these roles through controlled in vitro and in vivo experiments.

What are the key challenges in ensuring proper folding and activity of recombinant SdhC?

Ensuring proper folding and activity of recombinant SdhC presents several significant challenges due to its nature as a membrane protein and its role within a multisubunit complex:

  • Membrane insertion and topology:

    • SdhC contains transmembrane domains that must insert correctly into membranes

    • Improper folding commonly leads to aggregation or incorrect topology

    • Solutions include:

      • Using expression hosts with appropriate membrane insertion machinery

      • Employing detergents that mimic the native membrane environment

      • Considering fusion partners that enhance membrane targeting

  • Heme incorporation:

    • As the cytochrome b560 subunit, SdhC contains a heme group

    • Successful recombinant expression requires proper heme incorporation

    • Strategies include:

      • Supplementing growth media with heme precursors

      • Co-expressing heme synthesis or incorporation factors

      • Selecting expression hosts with adequate heme synthesis pathways

  • Interaction with other subunits:

    • Native SdhC functions within the context of Complex II

    • Isolated SdhC may adopt non-native conformations

    • Approaches to address this include:

      • Co-expression with other Complex II subunits

      • Reconstitution with purified partner subunits

      • Using stabilizing agents or nanodiscs to maintain native-like environment

  • Translation initiation optimization:

    • mRNA structure around the start codon significantly impacts expression efficiency

    • Secondary structures can impede ribosome binding and processivity

    • Optimization strategies include:

      • Modifying codons to enhance translation initiation site accessibility

      • Using computational tools to predict and optimize mRNA structures

      • Applying simulated annealing approaches to identify optimal synonymous substitutions

  • Activity assessment challenges:

    • Isolated SdhC may lack measurable enzymatic activity

    • Function is typically assessed in the context of the complete Complex II

    • Functional assays may require:

      • Reconstitution with other subunits

      • Membrane incorporation

      • Specific electron acceptors and donors

      • Sensitive detection methods

What are the most significant research gaps in our understanding of SdhC function in D. discoideum?

Despite advances in understanding SdhC function, several significant research gaps remain that present opportunities for future investigation:

  • Molecular basis for subunit-specific phenotypes:
    While knockdown studies have revealed distinct phenotypic outcomes for different Sdh subunits, the molecular mechanisms underlying these differences remain poorly understood. Particularly intriguing is why SdhC knockdown causes growth defects on bacterial lawns without phagocytosis impairment, unlike SdhA knockdown .

  • Alternative functions beyond Complex II:
    The unique respiratory profile of SdhC knockdown cells, particularly the elevation of non-mitochondrial oxygen consumption, suggests potential roles beyond electron transport. Whether SdhC participates in signaling pathways, alternative protein complexes, or metabolic regulation requires further investigation .

  • Structural determinants of SdhC function:
    Detailed structure-function analyses identifying critical residues and domains within SdhC that contribute to its unique functions are lacking. This is particularly important for understanding how mutations might lead to disease in higher organisms.

  • Regulatory mechanisms controlling SdhC expression:
    Little is known about how SdhC expression is regulated in response to metabolic demands, environmental stressors, or developmental signals in D. discoideum. Understanding these regulatory mechanisms could provide insights into mitochondrial adaptation.

  • Comparative analysis across evolutionary spectrum:
    While some comparison between D. discoideum and mammalian systems has been made, comprehensive comparative analysis of SdhC function across the evolutionary spectrum would provide valuable context for understanding both conserved and divergent functions .

  • Integration with cellular signaling networks:
    How SdhC dysfunction affects or is affected by cellular signaling pathways, particularly energy-sensing mechanisms such as AMPK, remains to be fully elucidated. The differential activation of AMPK in SdhA versus SdhC knockdowns suggests complex regulatory interactions worthy of further study .

Addressing these gaps would significantly advance our understanding of how individual Complex II subunits contribute to mitochondrial function and cellular metabolism, potentially providing insights relevant to human mitochondrial disorders and metabolic diseases.

What methodological innovations might improve recombinant SdhC production and functional analysis?

Future advances in recombinant SdhC research will likely depend on methodological innovations in several areas:

  • Expression system optimization:

    • Development of specialized membrane protein expression hosts with enhanced capacity for proper membrane insertion and folding

    • Creation of inducible promoter systems with fine-tuned expression control to prevent toxicity

    • Engineering of synthetic expression systems that co-express chaperones and folding factors specific for membrane proteins

  • mRNA design algorithms:

    • Advanced computational tools that optimize not just codon usage but whole-transcript folding properties

    • Integration of machine learning approaches to predict expression success based on sequence features

    • Expansion of current translation initiation site accessibility models to incorporate broader sequence contexts

  • Membrane mimetics for purification and analysis:

    • New generations of nanodiscs, amphipols, or synthetic membranes that better preserve native protein conformations

    • High-throughput screening platforms for identifying optimal detergent or membrane mimetic conditions

    • Cryo-EM compatible stabilization systems for structural studies of membrane proteins

  • Activity assay developments:

    • Single-molecule techniques to measure electron transfer through individual SdhC molecules

    • Label-free detection methods for monitoring protein-protein interactions in membrane environments

    • Real-time assays for monitoring Complex II assembly kinetics and stability

  • In vivo analysis tools:

    • CRISPR-based approaches for precise genomic editing in D. discoideum to create tagged or mutated versions of SdhC

    • Improved mitochondrial targeting of fluorescent sensors to monitor local metabolic parameters

    • Development of D. discoideum strains with humanized versions of Complex II components for translational research

  • Integration of multi-omics approaches:

    • Simultaneous analysis of proteomics, metabolomics, and transcriptomics in response to SdhC manipulation

    • Systems biology modeling of respiratory chain function incorporating detailed kinetic parameters

    • Flux analysis techniques to trace metabolic adaptations to SdhC dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.