Recombinant Dictyostelium discoideum Sugar transporter SWEET1 (slc50a1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during the production process. If you have a particular tag type in mind, please inform us, and we will prioritize its inclusion.
Synonyms
slc50a1; DDB_G0287763; Sugar transporter SWEET1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
slc50a1
Target Protein Sequence
MEDEKNENLMTFIQFCATFITITLFIMPLKTIRLIIEKKNVGTVAGLQFISSVLNCFLWI SYALLTSNTTMLFVNSIGMMFSIYYVFNYWKNINQVRASRDYLKKVMIACVLAITIISIS YYNTVDDLDTRISRLGFLSSVVCVLMFASPLEKMAIVIQSKNSEGMIINVAILSLLCGLS WTIFGLLLNDIYIYLPNILASILSFVQLTLIKLYPPQILL
Uniprot No.

Target Background

Function
Mediates both low-affinity uptake and efflux of sugar across the membrane.
Database Links
Protein Families
SWEET sugar transporter family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the genetic identity of Dictyostelium discoideum SWEET1?

Dictyostelium discoideum SWEET1 is encoded by the gene slc50a1 (also identified as DDB_G0287763) and has been characterized as a hypothetical protein DDB_G0287763 in some databases . The protein belongs to the solute carrier family 50, which consists of sugar efflux transporters found across multiple species. Unlike homologs in other organisms that have been extensively characterized, the D. discoideum SWEET1 transporter remains relatively underexplored, presenting opportunities for novel research contributions.

How does D. discoideum SWEET1 compare structurally with SWEET1 proteins from other organisms?

D. discoideum SWEET1 shares functional characteristics with SWEET1 homologs from various species including human (SLC50A1/RAG1AP1), mouse (Slc50a1/Rag1ap1), Xenopus laevis, and zebrafish (slc50a1/rag1ap1) . While complete structural analysis data is limited, the conservation of the SLC50 family across evolutionarily distant organisms suggests fundamental importance in cellular sugar transport mechanisms. Comparative studies using recombinant proteins from different species can provide insights into structural conservation and functional divergence throughout evolution.

What expression systems are most effective for producing recombinant D. discoideum SWEET1?

Recombinant D. discoideum SWEET1 can be successfully produced using multiple expression systems including cell-free expression methods and traditional host systems such as E. coli, yeast, baculovirus, or mammalian cells . The choice of expression system depends on the research requirements:

  • Cell-free expression systems yield protein with ≥85% purity as determined by SDS-PAGE and are advantageous for rapid production without cellular constraints

  • E. coli expression is suitable for generating partial proteins when full-length expression proves challenging

  • Eukaryotic systems (yeast, baculovirus, or mammalian cells) may provide more appropriate post-translational modifications when studying functional aspects

For structural studies requiring high-purity preparations, additional purification steps beyond the standard protocols may be necessary to exceed the typical 85% purity threshold.

What are the optimal purification strategies for recombinant D. discoideum SWEET1?

Purification of recombinant D. discoideum SWEET1 typically achieves ≥85% purity using SDS-PAGE verification . For researchers requiring higher purity preparations, consider this methodological approach:

  • Initial capture: Utilize affinity chromatography (if the recombinant protein contains an affinity tag)

  • Intermediate purification: Apply ion exchange chromatography based on the theoretical isoelectric point

  • Polishing step: Implement size exclusion chromatography to remove aggregates and achieve >95% purity

  • Quality control: Confirm final purity through both SDS-PAGE and mass spectrometry analysis

For membrane proteins like SWEET1, consider incorporating detergents such as n-dodecyl β-D-maltoside during purification to maintain native conformation and functionality.

How can researchers verify the functional activity of purified recombinant D. discoideum SWEET1?

Verification of functional activity requires transport assays adapted specifically for sugar transporters:

  • Liposome reconstitution assay: Incorporate purified SWEET1 into liposomes and measure radioactively labeled sugar transport

  • Whole-cell uptake studies: Express SWEET1 in transport-deficient cell lines and quantify cellular uptake of fluorescent sugar analogs

  • Electrophysiological measurements: For direct measurement of transport kinetics, use patch-clamp techniques after expression in Xenopus oocytes

When establishing functionality, consider comparing kinetic parameters with SWEET1 homologs from other species to identify conserved or divergent functional properties.

What technical considerations are important when working with D. discoideum cellular systems?

When conducting research with D. discoideum, several methodological considerations are crucial:

  • Growth conditions: D. discoideum cells are typically grown axenically in HL-5 medium or on bacterial lawns (commonly K. aerogenes)

  • Development induction: For development studies, cells should be washed and resuspended in PDF buffer (33 mM NaH₂PO₄, 10.6 mM Na₂HPO₄, 20 mM KCl, 6 mM MgSO₄, pH 5.8)

  • Oxygen sensitivity: D. discoideum development is oxygen-sensitive, requiring controlled O₂/N₂ flow chambers for studies involving oxygen sensing

  • Genetic manipulation: Transformation can be performed via electroporation, with selection using appropriate antibiotics (as shown in Table 1 from the search results)

StrainParental strainDrug resistanceGenotypeGnt1 activityReference
Ax3NC-4NonephyA+/gnt1+ (normal)+
Various mutant strainsAx3Blasticidin S, Hygromycin, or G418Various modificationsVariable

How can D. discoideum SWEET1 be integrated into studies of evolutionary conservation of sugar transport mechanisms?

To investigate evolutionary conservation of sugar transport mechanisms using D. discoideum SWEET1:

  • Comparative sequence analysis: Align SWEET1 sequences from diverse organisms (human, mouse, Xenopus, zebrafish, and D. discoideum) to identify conserved domains

  • Heterologous expression studies: Express D. discoideum SWEET1 in other model organisms to assess functional complementation

  • Domain swapping experiments: Create chimeric proteins between D. discoideum SWEET1 and mammalian homologs to identify functionally critical regions

  • Structural comparison: Develop structural models based on crystallography data from homologs to predict conserved transport mechanisms

This approach can reveal whether sugar transport mechanisms represent early evolutionary adaptations conserved across eukaryotic lineages.

How does oxygen sensing in D. discoideum relate to SWEET1 function and cellular metabolism?

While direct evidence linking SWEET1 to oxygen sensing is limited in the provided search results, D. discoideum possesses sophisticated oxygen-sensing mechanisms involving prolyl 4-hydroxylase (P4H1) . Researchers investigating potential connections should consider:

  • Co-expression analysis: Examine whether SWEET1 expression changes under varying oxygen conditions alongside known oxygen-responsive genes

  • Metabolic profiling: Compare sugar utilization in wild-type versus SWEET1-knockout strains under normoxic and hypoxic conditions

  • Interaction studies: Investigate whether SWEET1 interacts with components of oxygen-sensing pathways, such as Skp1 or P4H1

  • Developmental phenotyping: Analyze developmental progression in SWEET1-deficient strains at different oxygen concentrations

D. discoideum's P4H1 functions as an oxygen sensor that controls culmination during development , suggesting a potential regulatory relationship between oxygen availability, sugar transport, and developmental progression.

What approaches can resolve contradictory findings regarding SWEET1 function in D. discoideum?

When faced with contradictory data regarding SWEET1 function, implement these resolution strategies:

  • Strain verification: Confirm genetic background of D. discoideum strains, as phenotypic differences may arise from unintended mutations

  • Complementation studies: Reintroduce wild-type or mutant SWEET1 into knockout strains to verify phenotype rescue

  • Alternative knockout approaches: Generate SWEET1-deficient strains using multiple methods (CRISPR-Cas9, homologous recombination) to confirm consistency of phenotypes

  • Condition-dependent analysis: Test SWEET1 function under diverse conditions (nutrient availability, developmental stages, oxygen levels) to identify context-dependent functions

  • Quantitative approaches: Apply rigorous statistical analysis to experimental data to distinguish biological variation from experimental artifacts

This systematic approach helps resolve apparent contradictions that may arise from differences in experimental conditions or genetic backgrounds.

What genetic manipulation strategies are most effective for studying SWEET1 function in D. discoideum?

For genetic manipulation of SWEET1 in D. discoideum, consider these methodological approaches:

  • Gene disruption: Create knockout strains using homologous recombination with selection markers (blasticidin S, hygromycin, or G418)

  • Complementation: Verify phenotypes by expressing wild-type SWEET1 under native or inducible promoters

  • Point mutations: Introduce specific mutations to analyze structure-function relationships (similar to the D102A mutation approach used for Gnt1)

  • Expression vectors: Utilize stage-specific promoters (such as ecmA for prestalk cell expression) to control timing and location of expression

  • Multi-gene manipulation: Create double mutants (e.g., SWEET1/P4H1 double knockout) to investigate pathway interactions

Selection and phenotypic verification should follow established protocols for D. discoideum, including growth on bacterial lawns and development on cellulose acetate filters .

How can researchers design experiments to distinguish between transport and regulatory functions of SWEET1?

To differentiate between direct transport functions and potential regulatory roles of SWEET1:

This multifaceted approach can reveal whether SWEET1 functions solely as a transporter or has additional regulatory roles in D. discoideum biology.

What considerations are important when designing antibodies against D. discoideum SWEET1 for immunological studies?

When developing antibodies against D. discoideum SWEET1:

  • Epitope selection: Choose unique regions that distinguish SWEET1 from other transporters, ideally avoiding highly conserved domains

  • Species specificity: Consider generating species-specific antibodies (as demonstrated with DpGnt1 antibodies that did not cross-react with D. discoideum proteins)

  • Multiple antibody approach: Develop antibodies against different regions to enable detection of potential processing events or splice variants

  • Validation strategy: Verify specificity using SWEET1-knockout strains as negative controls

  • Application optimization: Test antibodies in multiple applications (Western blot, immunofluorescence, immunoprecipitation) with appropriate controls

For optimal results, consider purified recombinant SWEET1 protein (≥85% purity) as an immunogen rather than synthetic peptides, which may not represent native conformations.

How might SWEET1 contribute to developmental regulation in D. discoideum?

D. discoideum's developmental cycle involves complex transitions from unicellular to multicellular states, potentially involving SWEET1-mediated sugar transport:

  • Stage-specific expression: Investigate SWEET1 expression throughout development using RNA sequencing and protein analysis

  • Cell-type specificity: Determine whether SWEET1 is differentially expressed in prestalk versus prespore cells during slug formation

  • Developmental phenotypes: Analyze developmental progression in SWEET1-deficient strains under varying nutritional conditions

  • Integration with known pathways: Examine SWEET1 interaction with established developmental regulators such as the cAMP signaling pathway

  • Promoter analysis: Identify regulatory elements controlling SWEET1 expression during development

This research direction could reveal whether SWEET1 contributes to the energy requirements of specific developmental transitions, similar to how the P4H1-Skp1 pathway regulates culmination in response to oxygen availability .

What role might SWEET1 play in D. discoideum's adaptation to environmental stressors?

To explore SWEET1's potential role in stress adaptation:

  • Stress response profiling: Monitor SWEET1 expression under various stressors (temperature, pH, osmotic pressure, nutrient limitation)

  • Survival assays: Compare survival rates of wild-type versus SWEET1-deficient strains under stress conditions

  • Metabolic rewiring: Investigate whether SWEET1 facilitates metabolic adaptations during environmental transitions

  • Cross-talk with stress pathways: Examine interactions between SWEET1 and known stress response elements

  • Evolutionary comparison: Analyze whether stress-related functions of SWEET1 are conserved across species

Understanding SWEET1's role in stress responses could provide insights into fundamental cellular adaptation mechanisms conserved throughout evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.