Recombinant Dictyostelium discoideum TM2 domain-containing protein DDB_G0278163 (DDB_G0278163)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0278163; TM2 domain-containing protein DDB_G0278163
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-161
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0278163
Target Protein Sequence
MGHHHHHHGGSGHHHHHHHHGSGHYGGGAVLVTPIVTPVPVVYGSRSSSYCPKSMTVAYV
LWFFFGILGFHRLYLGRVGTFFLYFFTAGVFGLGWLFDAFYTHKMVKHYNECEFTKSCVG
QSPPATIPIYQSEGAYPTYQQVPQQPPQFYQPQQQQPQYQP
Uniprot No.
Target Background
Database Links
KEGG: ddi:DDB_G0278163
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
