Recombinant Dictyostelium discoideum TM2 domain-containing protein DDB_G0287015 (DDB_G0287015)

Shipped with Ice Packs
In Stock

Description

Overview of DDB_G0287015

DDB_G0287015 is a full-length recombinant protein (1–137 amino acids) encoded by the DDB_G0287015 gene in Dictyostelium discoideum. Its TM2 domain suggests involvement in transmembrane signaling or structural roles, though specific biological functions remain under investigation . The recombinant version is expressed in E. coli with an N-terminal His tag for purification .

Experimental Challenges

  • Pathway Data Gaps: Current literature lacks explicit pathway annotations (e.g., signal transduction, cytoskeletal remodeling) for DDB_G0287015 .

  • Interaction Partners: No confirmed protein interaction partners are documented in available sources .

Comparative Analysis of Recombinant Forms

AttributeHis-Tagged (RFL21007DF)Untagged (CSB-CF687632DKK)
Expression SystemE. coliE. coli
Tag PresenceHis (N-terminal)Not specified
BufferTris/PBS + trehaloseTris-based + glycerol
Purity>90%Not explicitly stated

Research Considerations

  1. Functional Studies: Future work should prioritize knockdown/knockout experiments in Dictyostelium to elucidate in vivo roles.

  2. Structural Analysis: X-ray crystallography or cryo-EM could resolve TM2 domain interactions.

  3. Cross-Species Comparison: Homologs in other eukaryotes (e.g., Homo sapiens) may inform conserved functions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
DDB_G0287015; TM2 domain-containing protein DDB_G0287015
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0287015
Target Protein Sequence
MSHHHHHHQASLVVAYLLLIFLGFFGVHRFYVGRTISGVVYLLTGGIFGIGYIVDFFLLP SLVCHYNNKHHDHTTVIVSPTPVVYQSGSQHYAPYQPQPYYAQQPIQPQQQQYYQQPYQQ QQYQPQPYQPNSPQYQP
Uniprot No.

Target Background

Database Links
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining DDB_G0287015 protein stability and activity?

For optimal stability, the recombinant DDB_G0287015 protein should be stored at -20°C in its shipping buffer (typically Tris-based buffer with 50% glycerol). For extended storage periods, conservation at -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

Methodological approach:

  • Upon receiving the protein, make small working aliquots to minimize freeze-thaw cycles

  • Store stock solutions at -80°C for long-term preservation

  • For weekly experiments, maintain a working aliquot at 4°C

  • Monitor protein stability through periodic activity assays or structural analysis

How should experiments be designed to investigate the potential bacteriolytic properties of DDB_G0287015?

When investigating potential bacteriolytic properties of DDB_G0287015, a systematic experimental design approach is essential:

Step 1: Define Variables

  • Independent variables: Protein concentration, pH conditions, bacterial strains

  • Dependent variables: Bacterial survival rates, membrane integrity, bacteriolytic activity

  • Control variables: Temperature, incubation time, buffer composition

Step 2: Experimental Design Framework

  • pH-dependent activity assay: Since Dictyostelium phagosomes are highly acidic (pH ~2-3.5), test protein activity across pH range 2-7

  • Bacterial challenge panel: Include both Gram-positive and Gram-negative bacteria, with special attention to Klebsiella pneumoniae (known to be sensitive to Dictyostelium bacteriolytic proteins)

  • Control experiments: Include both positive controls (known bacteriolytic proteins like AlyA) and negative controls (buffer only)

Experimental GrouppHProtein ConcentrationBacterial Strain
Treatment 12.010 μg/mlK. pneumoniae WT
Treatment 22.010 μg/mlK. pneumoniae waaQ mutant
Treatment 33.510 μg/mlK. pneumoniae WT
Treatment 47.010 μg/mlK. pneumoniae WT
Control 12.00K. pneumoniae WT
Control 22.010 μg/ml AlyAK. pneumoniae WT

Step 3: Data Collection and Analysis

  • Measure bacterial survival using colony-forming unit (CFU) counts

  • Assess membrane integrity through fluorescence-based viability assays

  • Apply statistical analysis (ANOVA) to determine significant differences between treatments

Based on previous research with bacteriolytic proteins in Dictyostelium, activity is expected to be highest at very acidic pH, mimicking phagosomal conditions .

What considerations should be taken when designing knockout or overexpression experiments for DDB_G0287015 in Dictyostelium discoideum?

When designing genetic manipulation experiments for DDB_G0287015:

Knockout Strategy:

  • Design CRISPR-Cas9 or homologous recombination constructs targeting the DDB_G0287015 gene

  • Transform Dictyostelium discoideum AX2 cells using established protocols (cells maintained in HL5 medium at 22°C)

  • Confirm gene deletion through PCR and Western blot analysis

  • Assess phenotypic changes in:

    • Growth rate in axenic culture

    • Development on filter paper with developmental buffer

    • Bacterial killing efficiency (especially with K. pneumoniae)

    • Phagosome acidification and maturation

Overexpression Approach:

  • Create an expression vector with DDB_G0287015 fused to a detection tag (similar to the ALFA tag used for BadA protein)

  • Transform Dictyostelium cells and select transformants

  • Verify expression levels through Western blot

  • Test for enhanced bacteriolytic activity in cellular extracts at pH 2.0

  • Assess whether bacterial killing is accelerated compared to parental cells

Important Considerations:

  • Include appropriate controls (wild-type and empty vector transformants)

  • Test multiple independent clones to rule out position effects

  • For bacteriolytic assays, compare activity under non-reducing and reducing conditions, as intramolecular disulfide bonds may be important for protein function (as observed with BadA protein)

How does DDB_G0287015 relate structurally and functionally to the bacteriolytic Bad protein family in Dictyostelium?

While direct experimental evidence linking DDB_G0287015 to the Bad protein family is not established in the provided literature, a comparative analysis approach can be used to investigate potential relationships:

Sequence Analysis Methodology:

  • Perform sequence alignment between DDB_G0287015 and BadA, BadB, and BadC proteins

  • Identify shared domains, particularly focusing on the DUF3430 domain and signal sequences

  • Analyze secondary structure predictions to identify structural similarities

Functional Comparison Strategy:

  • Conduct side-by-side bacteriolytic assays at acidic pH

  • Compare expression patterns during development and bacterial challenge

  • Assess subcellular localization to determine if DDB_G0287015 is trafficked to phagosomes like the Bad proteins

Biochemical Property Analysis:
BadA has a theoretical isoelectric point of 4.19 and molecular weight of 19.3 kDa . Comparative analysis of DDB_G0287015's biochemical properties with these parameters can provide insights into potential functional similarities.

A key experimental approach would be to perform immunoprecipitation with antibodies against DDB_G0287015 and test the precipitates for bacteriolytic activity, similar to the experiment described for BadA where depletion of BadA from cell extracts decreased bacteriolytic activity by approximately 37±5% .

What techniques are most effective for analyzing the potential roles of polyglutamine tracts in DDB_G0287015?

The C-terminal region of DDB_G0287015 contains multiple glutamine-rich repeats. Given that Dictyostelium proteins with polyglutamine tracts remain soluble under normal conditions , the following methodological approaches are recommended:

Structural Analysis:

  • Circular dichroism spectroscopy to assess secondary structure changes under different pH conditions

  • Nuclear magnetic resonance (NMR) spectroscopy focusing on the polyQ tract regions

  • Limited proteolysis followed by mass spectrometry to determine domain boundaries and stability

Functional Interrogation:

  • Create truncated constructs with and without the polyQ regions to assess their contribution to bacteriolytic activity

  • Test solubility and aggregation propensity under stress conditions (heat shock, chemical stress)

  • Fluorescence recovery after photobleaching (FRAP) to assess mobility and aggregation in vivo

Comparative Analysis:
A table comparing properties of polyQ-containing proteins in Dictyostelium versus other organisms:

PropertyDDB_G0287015Typical PolyQ Proteins in Other Organisms
Aggregation tendencyLow (predicted)Often high, especially with expanded tracts
Function of polyQUnknown, potentially related to protein-protein interactionsProtein interactions, transcriptional regulation
Cellular distributionLikely endosomal/phagosomal based on related proteinsPredominantly nuclear or cytoplasmic
Response to stressTo be determinedOften increased aggregation

Research on polyQ-containing proteins in Dictyostelium suggests that this organism possesses properties that suppress protein aggregation , making it an interesting model for studying how polyQ tracts can be maintained in a functional conformation.

What are the most effective methods for purifying recombinant DDB_G0287015 while maintaining its native conformation and activity?

For optimal purification of functional DDB_G0287015:

Step-by-Step Purification Protocol:

  • Expression system selection: Based on previous success with other Dictyostelium proteins, express in E. coli, yeast, baculovirus, or mammalian cell systems

  • Lysis buffer optimization: Since the protein may function at acidic pH, test various buffer systems covering both neutral pH (for initial purification) and acidic pH (for activity)

  • Purification strategy:

    • IMAC (Immobilized Metal Affinity Chromatography) using the His-tag present in the sequence

    • Anion exchange chromatography at pH 8.0 (given the predicted acidic pI)

    • Size exclusion chromatography for final polishing

Critical Considerations:

  • Maintain reducing agents during purification to prevent non-native disulfide formation

  • Include protease inhibitors to prevent degradation

  • Test activity at each purification step to ensure functionality is preserved

  • Consider purification under non-denaturing conditions to maintain native conformation

Activity Preservation:
The purification strategy should be informed by the method successfully used for bacteriolytic proteins in Dictyostelium, where anion exchange chromatography (elution with 150-300 mM NaCl) followed by size exclusion chromatography effectively maintained bacteriolytic activity .

How can researchers design experiments to investigate the pH-dependent activity of DDB_G0287015 in relation to phagosomal function?

Given that Dictyostelium phagosomes can reach pH as low as 2.5 , the following experimental design is recommended:

1. in vitro pH-Activity Profile:

  • Prepare buffers covering pH range 2.0-7.0 (0.5 unit increments)

  • Test recombinant DDB_G0287015 activity against bacterial substrates at each pH

  • Measure both kinetic parameters and endpoint bacteriolysis

  • Include controls with heat-inactivated protein

2. Cellular Localization under Different pH Conditions:

  • Create fluorescently tagged DDB_G0287015 constructs

  • Use pH-sensitive fluorescent probes to simultaneously visualize protein localization and local pH

  • Perform live-cell imaging during phagocytosis of bacteria

  • Colocalize with markers for different endosomal/phagosomal compartments

3. Phagosome Isolation and Function Testing:

  • Isolate phagosomes at different maturation stages

  • Quantify DDB_G0287015 levels in each fraction

  • Correlate protein levels with bacteriolytic activity and pH

4. pH Manipulation Experiments:

  • Use pharmacological agents (e.g., bafilomycin A1) to inhibit phagosomal acidification

  • Assess the impact on DDB_G0287015 activity and bacterial killing

  • Compare results with known pH-dependent phagosomal proteins

A controlled experimental design matrix might look like:

Experimental ConditionpHBacterial StrainMeasurement
Native phagosomesNatural (~2.5)K. pneumoniaeBacterial survival, DDB_G0287015 activity
Bafilomycin-treatedElevated (~5.0)K. pneumoniaeBacterial survival, DDB_G0287015 activity
Isolated protein2.0-7.0 rangeK. pneumoniaeDirect bacteriolytic activity

How can the study of DDB_G0287015 contribute to understanding evolutionary conservation of antimicrobial mechanisms?

The study of DDB_G0287015 offers unique insights into the evolution of antimicrobial defense mechanisms:

Methodological Approach:

  • Comparative Genomics:

    • Identify homologs of DDB_G0287015 across evolutionary lineages

    • Analyze conservation of key domains, particularly the TM2 domain

    • Construct phylogenetic trees to trace evolutionary history

  • Functional Conservation Testing:

    • Express homologs from different species in Dictyostelium DDB_G0287015 knockout background

    • Test functional complementation through bacterial killing assays

    • Characterize pH optima across homologs to identify evolutionary shifts

  • Structural Biology Comparative Analysis:

    • Determine structures of DDB_G0287015 and related proteins

    • Map conserved residues to functional sites

    • Identify evolutionary hotspots of adaptation

This research direction is particularly valuable because Dictyostelium represents an evolutionary position at the interface between unicellular and multicellular life, offering insights into primitive innate immunity mechanisms that may have evolved into more complex systems in higher organisms .

What experimental approaches would be most effective for investigating potential interactions between DDB_G0287015 and other phagosomal proteins in Dictyostelium?

To systematically investigate protein-protein interactions:

1. Proximity-based Interaction Mapping:

  • BioID or APEX2 proximity labeling with DDB_G0287015 as the bait

  • Perform labeling at different time points during phagosome maturation

  • Mass spectrometry identification of proximal proteins

  • Validation of key interactions through co-immunoprecipitation

2. Genetic Interaction Analysis:

  • Create double mutants combining DDB_G0287015 knockout with mutations in known phagosomal proteins (e.g., Kil1, Kil2)

  • Assess synthetic phenotypes in bacterial killing assays

  • Perform epistasis analysis to position DDB_G0287015 in phagosomal maturation pathways

3. Dynamic Interaction Studies:

  • Fluorescence resonance energy transfer (FRET) between tagged DDB_G0287015 and candidate interactors

  • Live-cell imaging during phagocytosis

  • Correlation of interaction timing with phagosomal pH changes

4. Biochemical Complex Characterization:

  • Blue native PAGE to identify native complexes containing DDB_G0287015

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Crosslinking mass spectrometry to map interaction interfaces

Special attention should be paid to potential interactions with the Kil1 sulfotransferase and Kil2 magnesium pump, as these proteins have been established as critical for bacterial killing in Dictyostelium phagosomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.