Recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase (gpsn2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
gpsn2; DDB_G0270270; Very-long-chain enoyl-CoA reductase; Synaptic glycoprotein SC2-like protein; Trans-2,3-enoyl-CoA reductase; TER
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
gpsn2
Target Protein Sequence
MVDIKVVSQRSKKEVGSFSTSSSTTVGELKKQISSKTRLGTERIRLAVPSKTSKLPNAFE ALGKDSDLVSKHVGADSTLYFKDLGPQISWSLVFICEYAGPLFVYPIFYFLSNLIYGTDS PKSFAQKVALVCYSLHYIKRIYETIFVHRFSHGTMPIFNLFKNCSYYWGCTAMVSYFVNH PLYTEAPIERVYLGLGLWIIGEVFNYICHIQLRNLRPAGSTERKIPRGLLFEFVSCPNYT VEILSWIGFSILTQTLTSWIFALMGAAQMWIWAVGKHRRYRKEFGDKYPKSRKILIPFLL
Uniprot No.

Target Background

Function

This recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase (gpsn2) catalyzes the final step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the two-carbon addition to long- and very long-chain fatty acids (VLCFAs) in each cycle. It reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA, enabling further elongation through subsequent cycles. Consequently, this enzyme contributes to the biosynthesis of VLCFAs with varying chain lengths, which serve as precursors for membrane lipids and lipid mediators, and are involved in diverse biological processes.

Database Links
Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Trans-2,3-enoyl-CoA reductase in Dictyostelium discoideum?

Trans-2,3-enoyl-CoA reductase (gpsn2) in Dictyostelium discoideum is an enzyme involved in fatty acid metabolism, particularly in the synthesis of very-long-chain fatty acids. It is also known as synaptic glycoprotein SC2-like protein. The protein functions as a reductase with the Enzyme Commission number EC 1.3.1.38 and is identified in the UniProt database under accession number Q55C17. This enzyme catalyzes a critical step in fatty acid elongation by reducing trans-2,3-enoyl-CoA intermediates during the synthesis of fatty acids .

How does Dictyostelium discoideum serve as a model organism for studying Trans-2,3-enoyl-CoA reductase?

Dictyostelium discoideum serves as an excellent model organism for studying Trans-2,3-enoyl-CoA reductase due to its unique life cycle and developmental characteristics. As a unicellular slime mold that can develop into a multicellular fruiting body during starvation, it offers researchers an opportunity to study the role of this enzyme in both unicellular and multicellular contexts. Dictyostelium undergoes large-scale shifts in gene expression during development, making it valuable for investigating how Trans-2,3-enoyl-CoA reductase expression changes during different developmental stages . The organism's relatively simple genome and well-characterized development provide a clean background for studying specific gene functions through knockout or overexpression experiments. Studying the enzyme in this model organism can provide insights into fundamental aspects of lipid metabolism that may be conserved across species, including mammals .

What are the optimal conditions for expressing Recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase?

For optimal expression of Recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase, researchers should consider the following methodological approach:

  • Expression System Selection: The choice between bacterial (E. coli), yeast, insect, or mammalian cell expression systems should be based on the need for post-translational modifications. For basic enzymatic studies, E. coli BL21(DE3) strains are often sufficient, while eukaryotic systems may be necessary for studying interaction partners.

  • Temperature and Induction Parameters:

    • E. coli: Expression at lower temperatures (16-20°C) after induction with 0.1-0.5mM IPTG often yields higher soluble protein.

    • Yeast/insect cells: Standard protocols with optimized induction timing based on growth curves.

  • Buffer Optimization:

    • Lysis buffer: 50mM Tris-HCl (pH 7.5-8.0), 300mM NaCl, 10% glycerol, 1mM DTT, protease inhibitors

    • Storage buffer: Tris-based buffer with 50% glycerol as used in commercial preparations

  • Purification Strategy: A two-step purification process using affinity chromatography followed by size exclusion chromatography typically yields protein of sufficient purity for enzymatic assays.

The recombinant protein should be stored at -20°C for short-term or -80°C for long-term storage, with avoiding repeated freeze-thaw cycles to maintain enzymatic activity .

How can researchers verify the enzymatic activity of purified Trans-2,3-enoyl-CoA reductase?

Verification of Trans-2,3-enoyl-CoA reductase enzymatic activity requires a multi-faceted approach:

  • Spectrophotometric Assay: Monitor the oxidation of NADPH (decrease in absorbance at 340nm) in the presence of trans-2,3-enoyl-CoA substrates. The reaction mixture typically contains:

    • 100mM potassium phosphate buffer (pH 7.2)

    • 0.1mM NADPH

    • 25-100μM trans-2,3-enoyl-CoA substrate

    • 1-5μg purified enzyme

    Calculate activity using the extinction coefficient of NADPH (ε₃₄₀ = 6,220 M⁻¹cm⁻¹).

  • Substrate Specificity Analysis: Test activity across different chain-length substrates to establish substrate preference using:

SubstrateChain LengthRelative Activity (%)Km (μM)
Trans-2-hexenoyl-CoAC645-6035-50
Trans-2-decenoyl-CoAC1080-9520-30
Trans-2-hexadecenoyl-CoAC1610015-25
Trans-2-eicosenoyl-CoAC2070-8525-40
  • LC-MS Analysis: Confirm product formation by analyzing the reaction products using liquid chromatography-mass spectrometry.

  • Control Experiments: Include negative controls (heat-inactivated enzyme) and positive controls (commercially available reductases) to validate assay specificity .

How does Trans-2,3-enoyl-CoA reductase contribute to lipid metabolism in Dictyostelium discoideum development?

Trans-2,3-enoyl-CoA reductase plays a crucial role in Dictyostelium discoideum development through its impact on lipid metabolism. During the transition from unicellular to multicellular states, significant changes in membrane composition and lipid signaling occur, with Trans-2,3-enoyl-CoA reductase modulating these processes in several ways:

  • Developmental Regulation: The enzyme's expression level changes during different developmental stages, with evidence suggesting it is regulated in response to nutritional status and developmental signals. This temporal regulation indicates specialized functions during specific developmental transitions .

  • Membrane Remodeling: As Dictyostelium transitions to multicellularity, extensive membrane remodeling occurs. Trans-2,3-enoyl-CoA reductase contributes to this by facilitating the synthesis of very-long-chain fatty acids that are incorporated into specialized membrane domains. These domains are critical for cell-cell adhesion and signaling during aggregation and subsequent morphogenesis .

  • Fatty Acid Profile Modulation: Research has shown that the enzyme particularly influences the omega-3 fatty acid profile, which directly impacts membrane fluidity and the formation of specialized signaling platforms. Studies with Tecr in other systems demonstrate that this enzyme class is essential for maintaining appropriate levels of polyunsaturated fatty acids in cellular membranes .

  • Metabolic Shift Support: During starvation-induced development, Dictyostelium undergoes significant metabolic reprogramming. Trans-2,3-enoyl-CoA reductase helps facilitate this shift by modulating the fatty acid pools available for energy utilization versus structural roles .

The enzyme's activity creates a sophisticated feedback system with transcriptional networks, potentially influencing chromatin organization through loop formation involving convergent gene pairs, as has been observed in the spatial organization of the Dictyostelium genome .

What is the relationship between chromatin spatial organization and Trans-2,3-enoyl-CoA reductase gene expression in Dictyostelium?

The relationship between chromatin spatial organization and Trans-2,3-enoyl-CoA reductase gene expression in Dictyostelium involves sophisticated regulatory mechanisms:

  • Chromatin Loop Structures: Recent research has revealed that the Dictyostelium 3D genome is organized into positionally conserved, largely consecutive, non-hierarchical loops at the onset of multicellular development. These loops appear to be critical for gene regulation, with highly transcribed genes often positioned at loop anchors. Trans-2,3-enoyl-CoA reductase gene activity may be influenced by or contribute to these loop structures .

  • Convergent Gene Pair Dynamics: Loop anchors in Dictyostelium are predominantly positioned by genes in convergent orientation. If the Trans-2,3-enoyl-CoA reductase gene forms part of such a convergent pair, it could act as a bidirectional extrusion barrier or "diode" that controls passage of cohesin extruders through transcription-mediated mechanisms. This would integrate its transcriptional regulation with broader chromatin architecture .

  • Transcriptional Coherence in Loop Domains: Research has shown that genes within loop interiors frequently display coherent expression changes during development. This suggests that the Trans-2,3-enoyl-CoA reductase gene may be co-regulated with functionally related genes if they share a chromatin loop domain, creating a coordinated response to developmental signals .

  • Extrusion-Driven Folding: Hi-C-based observations and polymer simulations suggest that chromatin loop profiles may arise from interplay between transcription and extrusion-driven folding. The transcriptional status of Trans-2,3-enoyl-CoA reductase could therefore both influence and be influenced by these dynamic chromatin processes .

This relationship exemplifies how gene expression and three-dimensional genome organization are interdependent processes that jointly contribute to developmental regulation in Dictyostelium.

How does the function of Trans-2,3-enoyl-CoA reductase in Dictyostelium compare to its homologs in mammalian systems?

The function of Trans-2,3-enoyl-CoA reductase in Dictyostelium shares important similarities but also exhibits distinct differences compared to its mammalian homologs:

  • Structural Conservation: Sequence analysis reveals conserved catalytic domains between Dictyostelium Trans-2,3-enoyl-CoA reductase (gpsn2) and mammalian homologs like TECR (Trans-2,3-enoyl-CoA reductase) and TECRL (Trans-2,3-enoyl-CoA reductase-like), suggesting preservation of core enzymatic function throughout evolution. Both contain characteristic NAD(P)H binding motifs and substrate recognition domains essential for catalytic activity .

  • Physiological Roles:

    • In Dictyostelium: Primarily involved in developmental transitions and cell differentiation during the unicellular-to-multicellular switch.

    • In Mammals: More specialized roles including:

      • Involvement in synaptic function (hence the "synaptic glycoprotein SC2-like" nomenclature)

      • Critical roles in neural development

      • Significance in cardiac function, with TECRL mutations linked to catecholaminergic polymorphic ventricular tachycardia (CPVT) and long QT syndrome

  • Metabolic Integration:

    • In Dictyostelium: Functions predominantly in basic fatty acid metabolism pathways.

    • In Mammals: Integrated into more complex lipid metabolism networks, including specialized roles in very-long-chain fatty acid synthesis in the endoplasmic reticulum and potential roles in sphingolipid metabolism .

  • Disease Relevance: While Dictyostelium Trans-2,3-enoyl-CoA reductase mutations primarily affect development and cellular differentiation, mammalian TECRL variants have been implicated in serious cardiac arrhythmias. Research has revealed that alterations in the TECRL gene are associated with clinical features of both long QT syndrome and CPVT, highlighting its critical role in cardiac electrophysiology that is not observed in Dictyostelium .

This comparative analysis demonstrates how a metabolic enzyme has evolved additional specialized functions in higher organisms while maintaining its ancestral catalytic activity.

How can Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase be used to study lipid metabolism disorders?

Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase serves as a valuable research tool for studying lipid metabolism disorders through several methodological approaches:

  • Model System Development: Researchers can engineer Dictyostelium strains with specific mutations in the gpsn2 gene that mirror human disease variants, particularly those found in TECRL associated with cardiac arrhythmias. This creates simplified models to study the biochemical consequences of enzyme dysfunction without the complexity of mammalian systems .

  • Functional Conservation Analysis: By performing complementation studies where human TECR/TECRL variants are expressed in gpsn2-knockout Dictyostelium, researchers can assess which functions are conserved across species. This approach helps identify which aspects of the protein's function are fundamental versus those that evolved for specialized mammalian physiologies .

  • Lipid Profile Characterization: High-resolution lipidomic analysis of wild-type versus gpsn2-mutant Dictyostelium provides insights into the specific lipid species affected by enzyme dysfunction. Recent research on related enzymes has shown that altered activity affects omega-3 fatty acid metabolism, which has implications for understanding how similar defects might manifest in human metabolic disorders .

  • Signaling Pathway Mapping: The relatively simple genetic background of Dictyostelium allows researchers to trace how Trans-2,3-enoyl-CoA reductase dysfunction impacts downstream signaling pathways. This is particularly valuable for understanding how lipid metabolism abnormalities trigger cascading cellular effects that ultimately manifest as disease symptoms .

  • Drug Screening Platform: Dictyostelium strains with defined Trans-2,3-enoyl-CoA reductase mutations can serve as initial screening platforms for potential therapeutic compounds, allowing for rapid assessment of molecules that might rescue enzymatic function before advancing to more complex mammalian models .

This multi-faceted approach leverages the genetic and developmental simplicity of Dictyostelium while capitalizing on the functional conservation of Trans-2,3-enoyl-CoA reductase to generate insights relevant to human lipid metabolism disorders.

What techniques can be used to study the interaction between Trans-2,3-enoyl-CoA reductase and other proteins in the fatty acid synthesis pathway?

To study the interactions between Trans-2,3-enoyl-CoA reductase and other proteins in the fatty acid synthesis pathway, researchers can employ several advanced techniques:

  • Co-Immunoprecipitation (Co-IP) with Proximity Labeling:

    • Traditional Co-IP using antibodies against Trans-2,3-enoyl-CoA reductase followed by mass spectrometry identification of binding partners

    • Enhanced proximity labeling approaches using BioID or APEX2 fusions with Trans-2,3-enoyl-CoA reductase to identify proteins in its vicinity within living cells

    • Quantitative comparison of interactomes under different developmental conditions to identify context-specific interactions

  • Förster Resonance Energy Transfer (FRET) and Bimolecular Fluorescence Complementation (BiFC):

    • Creation of fluorescent protein fusions with Trans-2,3-enoyl-CoA reductase and suspected interaction partners

    • Live-cell imaging to visualize protein-protein interactions in real-time during Dictyostelium development

    • Quantification of interaction strength through FRET efficiency measurements

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking of protein complexes followed by digestion and mass spectrometric analysis

    • Identification of precise interaction interfaces between Trans-2,3-enoyl-CoA reductase and its partners

    • Construction of detailed molecular models of multiprotein complexes involved in fatty acid synthesis

  • Chromatin Immunoprecipitation (ChIP) and Hi-C Analysis:

    • Investigation of potential associations between Trans-2,3-enoyl-CoA reductase and chromatin or transcription factors

    • Analysis of how enzyme activity influences chromatin looping and gene expression of related metabolic enzymes

    • Integration with transcriptomic data to build comprehensive regulatory networks

  • Functional Validation Through Genetic Approaches:

    • Creation of Dictyostelium strains with mutations in both Trans-2,3-enoyl-CoA reductase and interacting partners

    • Synthetic lethality screens to identify genetically interacting pathways

    • Rescue experiments with mutant variants to map functional domains involved in specific protein-protein interactions

These methodologies provide complementary data that, when integrated, offer a comprehensive view of how Trans-2,3-enoyl-CoA reductase functions within the broader context of fatty acid metabolism and cellular regulation.

How might Trans-2,3-enoyl-CoA reductase influence the development of the blood-brain barrier through lipid metabolism?

Recent research suggests that Trans-2,3-enoyl-CoA reductase may play a previously unrecognized role in blood-brain barrier (BBB) development through several lipid metabolism-dependent mechanisms:

  • Omega-3 Fatty Acid Regulation: Studies of trans-2-enoyl-CoA reductase (Tecr) in other systems have demonstrated that this enzyme class is critically involved in the metabolism of omega-3 fatty acids. Research has shown that Tecr expression in endothelial cells is directly associated with omega-3 fatty acid content, which in turn suppresses caveolae vesicle formation. This finding suggests a molecular mechanism by which Trans-2,3-enoyl-CoA reductase activity could regulate transcytosis across the BBB, a fundamental aspect of barrier function .

  • Developmental Timing Correlation: Tecr has been found to be highly expressed during barriergenesis (the formation of the blood-brain barrier) and decreases after BBB maturation. This temporal expression pattern strongly suggests a developmental role specifically during the critical period when the BBB establishes its characteristic selective permeability .

  • Knockout Phenotypes: Endothelial cell-specific knockout of Tecr has been observed to compromise angiogenesis due to delayed vascular sprouting. More significantly, EC-specific deletion of Tecr results in loss of restrictive vascular permeability from neonatal stages to adulthood, with high levels of transcytosis, even while maintaining tight junctions. This demonstrates that the enzyme's activity is specifically required for certain aspects of barrier function but not others .

  • Functional Consequences: The specific impact of Trans-2,3-enoyl-CoA reductase activity appears to be on suppressing transcytosis rather than affecting tight junction formation. This nuanced role highlights how lipid metabolism can selectively influence certain aspects of barrier functionality, potentially through effects on membrane microdomain organization that influences vesicular transport machinery .

These findings collectively suggest that Trans-2,3-enoyl-CoA reductase represents a potential therapeutic target for central nervous system diseases associated with BBB dysfunction, particularly those involving increased transcytosis rather than tight junction disruption.

What is the potential role of Trans-2,3-enoyl-CoA reductase in cardiac function and related disorders?

Emerging research has begun to reveal surprising connections between Trans-2,3-enoyl-CoA reductase family proteins and cardiac function, with significant implications for understanding and treating cardiac disorders:

  • TECRL Gene Variants and Arrhythmias: Recent studies have identified that alterations in the trans-2,3-enoyl-CoA reductase-like (TECRL) gene, a homolog of Dictyostelium gpsn2, are implicated in catecholaminergic polymorphic ventricular tachycardia (CPVT). This inherited arrhythmia syndrome is characterized by polymorphic ventricular tachycardia provoked by emotional stress or exercise. More intriguingly, TECRL variants have been associated with clinical features of both long QT syndrome (LQTS) and CPVT, suggesting a complex role in cardiac electrophysiology .

  • Early-Onset Manifestation: The TECRL-associated cardiac phenotypes demonstrate a pattern of early manifestation, with studies showing that approximately 35% of affected individuals become symptomatic before the age of 10 and 75% before the age of 20 years. This early-onset pattern suggests a fundamental role in cardiac development or homeostasis rather than a degenerative process .

  • Potential Mechanisms: While the exact molecular mechanisms remain under investigation, several hypotheses have emerged:

    • TECRL may influence membrane lipid composition affecting ion channel function

    • Altered fatty acid metabolism may impact energy availability to cardiomyocytes

    • Changes in signaling lipids could modify calcium handling in cardiac cells

    • Specialized lipid microdomains important for cardiac ion channel clustering may be disrupted

  • Mortality Risk: The significance of TECRL function is underscored by the high mortality rate associated with untreated CPVT (30%-40%), highlighting the critical nature of proper fatty acid metabolism for cardiac rhythm stability .

These findings suggest that further research into Trans-2,3-enoyl-CoA reductase family proteins may yield valuable insights for cardiac arrhythmia treatment, potentially opening new therapeutic avenues focused on lipid metabolism rather than direct ion channel modulation.

What are the challenges in purifying active Recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase?

Purifying active Recombinant Dictyostelium discoideum Trans-2,3-enoyl-CoA reductase presents several technical challenges that researchers should consider when designing their experimental approaches:

  • Protein Solubility Issues:

    • Trans-2,3-enoyl-CoA reductase contains hydrophobic domains that may cause aggregation during expression

    • Standard approaches to address this include:

      • Using fusion tags like MBP (maltose-binding protein) or SUMO to enhance solubility

      • Optimizing expression conditions with lower temperatures (16-18°C)

      • Testing various detergents for extraction (0.5-1% CHAPS often maintains activity while solubilizing the protein)

  • Cofactor Retention:

    • The enzyme requires NAD(P)H as a cofactor for activity

    • Maintaining cofactor association during purification requires buffer optimization:

      • Including low concentrations of NAD(P)H (10-50 μM) in purification buffers

      • Avoiding harsh elution conditions that may strip cofactors

      • Using dialysis rather than rapid buffer exchange to prevent cofactor loss

  • Storage Stability Challenges:

    • Enzymatic activity can decline rapidly under suboptimal storage conditions

    • Research indicates optimal preservation using:

      • Tris-based buffer with 50% glycerol as used in commercial preparations

      • Storage at -20°C for short-term or -80°C with flash-freezing for long-term

      • Addition of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidative inactivation

      • Aliquoting to avoid repeated freeze-thaw cycles

  • Activity Assay Optimization:

    • The spectrophotometric assay monitoring NADPH oxidation requires careful control:

      • Baseline drift correction due to non-enzymatic NADPH oxidation

      • Subtraction of background activity from host cell proteins

      • Confirmation of linearity across different enzyme concentrations

      • Accounting for potential substrate inhibition at higher concentrations

Addressing these challenges requires systematic optimization of expression, purification, and storage conditions, often necessitating multiple iterations to achieve preparations with consistently high specific activity suitable for detailed enzymological studies.

How can researchers effectively analyze the impact of Trans-2,3-enoyl-CoA reductase on cellular fatty acid profiles?

To effectively analyze the impact of Trans-2,3-enoyl-CoA reductase on cellular fatty acid profiles, researchers should implement a comprehensive analytical workflow:

  • Experimental Design for Comparative Analysis:

    • Generate Trans-2,3-enoyl-CoA reductase knockout or knockdown models in Dictyostelium discoideum

    • Create complementary overexpression systems

    • Establish controlled growth conditions with defined media to minimize variation

    • Sample cells at multiple developmental stages to capture dynamic changes

  • Lipid Extraction Optimization:

    • Implement Bligh-Dyer or Folch extraction methods with modifications optimized for Dictyostelium

    • Include internal standards spanning multiple lipid classes for accurate quantification

    • Perform extractions rapidly under nitrogen to prevent oxidation of polyunsaturated fatty acids

    • Consider fractionation to separate membrane lipids from storage lipids for more detailed analysis

  • Advanced Analytical Techniques:

    • Targeted Lipidomics:

      • Gas chromatography-mass spectrometry (GC-MS) for fatty acid methyl ester analysis

      • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for complex lipid analysis

    • Untargeted Approaches:

      • High-resolution MS with data-independent acquisition to discover novel lipid species

      • Ion mobility spectrometry-MS for separation of isomeric lipid species

  • Data Analysis and Integration:

    • Apply multivariate statistical methods including principal component analysis and hierarchical clustering

    • Integrate lipidomic data with transcriptomic and proteomic datasets to build comprehensive metabolic networks

    • Perform pathway enrichment analysis to identify systematically altered lipid metabolism pathways

    • Use stable isotope labeling to track flux through specific pathways affected by Trans-2,3-enoyl-CoA reductase activity

  • Functional Validation Approaches:

    • Test membrane properties (fluidity, domain organization) using fluorescence anisotropy or laurdan generalized polarization

    • Assess functional consequences of altered fatty acid profiles on specific cellular processes like endocytosis, phagocytosis, or chemotaxis

    • Perform rescue experiments with specific fatty acids to determine which species are most critical for phenotypic effects

This comprehensive analytical approach enables researchers to move beyond simple cataloging of changes to develop mechanistic understandings of how Trans-2,3-enoyl-CoA reductase influences cellular physiology through its effects on the lipidome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.