Recombinant Dictyostelium discoideum Transmembrane and coiled-coil domain-containing protein 1 homolog (tmco1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
tmco1; DDB_G0281489; Calcium load-activated calcium channel homolog; CLAC channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmco1
Target Protein Sequence
MAALEVLFILFVSIASSLASEGVSWLLVYRTENYKRGKANIDRLQIQLDKLVDQESETSS LSKKGNKDKKIEKIEEQLKIANKELSFSKMKSMFAVAISMIALFSYLNRIFDGVVVCKLP FVPIGFLQGISHRTIAGDDYTDCSMTFIYAICSMFIRNNIQLILGTAPPKTKQANPWALP EEKKTR
Uniprot No.

Target Background

Function

Function: A calcium-selective channel crucial for preventing the overfilling of calcium stores.

Database Links
Protein Families
TMCO1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary relationship between human TMCO1 and its D. discoideum homolog?

The D. discoideum TMCO1 homolog belongs to the evolutionarily conserved Oxa1 superfamily of proteins that are present in nearly all biological membranes derived from the plasma membrane of the cenancestor. This superfamily shares a conserved core structure of three transmembrane helices (TMHs) and a cytoplasmic helical hairpin . Evolutionary analysis indicates that TMCO1 is related to proteins involved in membrane protein biogenesis, including YidC, EMC3, and GET1 . The conservation of this structural arrangement across diverse species suggests fundamental roles in cellular physiology.

To establish the relationship between human and D. discoideum TMCO1:

  • Perform phylogenetic analysis using multiple sequence alignment tools

  • Analyze conserved domains and structural motifs

  • Compare key functional residues involved in calcium channel formation

  • Examine synteny analysis to identify genomic context conservation

How does TMCO1 function in calcium homeostasis within D. discoideum cells?

The human TMCO1 forms specialized channel structures through which calcium ions flow, primarily in the endoplasmic reticulum (ER) membrane. When calcium levels in the ER become excessive, four TMCO1 proteins assemble to form a functional channel that releases excess calcium into the cytoplasm . In D. discoideum, this calcium regulation function is likely conserved, given the fundamental importance of calcium signaling across eukaryotes.

Methodological approach for functional characterization:

  • Generate fluorescent calcium indicators targeted to specific organelles

  • Measure calcium flux using real-time imaging in wild-type and TMCO1-knockout D. discoideum cells

  • Perform patch-clamp electrophysiology to directly measure channel conductance

  • Use calcium-sensitive dyes to monitor organelle-specific calcium concentrations during developmental transitions

Knockdown experiments in other cell types have demonstrated that TMCO1 deficiency leads to increased intracellular calcium concentration, suggesting impaired calcium efflux from the ER .

What are the optimal conditions for expressing recombinant D. discoideum TMCO1 protein?

The expression of recombinant D. discoideum TMCO1 requires careful optimization due to its transmembrane nature and potential toxicity when overexpressed. Based on experiences with similar membrane proteins in D. discoideum:

Expression System Comparison:

Expression SystemYieldProtein FoldingMembrane IntegrationPurification Complexity
E. coliMediumOften misfoldedPoorHigh
Insect cellsHighGoodGoodMedium
D. discoideumMediumExcellentExcellentMedium
Mammalian cellsLowGoodGoodHigh

Methodological protocol:

  • Clone the D. discoideum TMCO1 gene into an expression vector with an inducible promoter

  • Add a purification tag (His6 or FLAG) at either the N- or C-terminus, avoiding disruption of transmembrane domains

  • Transform D. discoideum cells using electroporation

  • Select stable transformants and verify expression using Western blotting

  • Induce expression under mild conditions (18-22°C) to promote proper folding

  • Extract membrane fractions using detergent solubilization (CHAPS or DDM)

  • Purify using affinity chromatography followed by size exclusion chromatography

What are the most effective methods for studying TMCO1 calcium channel activity in D. discoideum?

Investigating the calcium channel activity of TMCO1 in D. discoideum requires specialized techniques that can measure calcium flux across membranes:

Methodological approaches:

  • Fluorescence-based calcium imaging:

    • Load cells with calcium-sensitive dyes (Fura-2, Fluo-4)

    • Utilize genetically encoded calcium indicators (GCaMPs) targeted to specific compartments

    • Measure fluorescence changes upon stimulation with calcium mobilizing agents

  • Electrophysiological recording:

    • Perform patch-clamp analysis on isolated ER membrane patches

    • Record single-channel currents under varying calcium concentrations

    • Compare wild-type and mutant channel properties

  • Calcium flux assays:

    • Isolate ER vesicles from D. discoideum cells

    • Load vesicles with calcium and measure release rates

    • Compare release kinetics in the presence of TMCO1 inhibitors or activators

  • Structural studies:

    • Use cryo-electron microscopy to visualize channel assembly

    • Identify the tetrameric arrangement of TMCO1 proteins under high calcium conditions

    • Map functional domains through site-directed mutagenesis

How does TMCO1 knockdown affect D. discoideum development and multicellular morphogenesis?

Given D. discoideum's unique life cycle involving single-cell and multicellular stages, TMCO1's role in calcium homeostasis may significantly impact development. Previous studies with other calcium-regulatory proteins have shown developmental abnormalities when disturbed.

Methodological approach:

  • Generate TMCO1 knockout strains using CRISPR-Cas9 or homologous recombination

  • Monitor developmental stages microscopically at defined intervals

  • Quantify timing of aggregation, mound formation, slug migration, and fruiting body development

  • Compare morphological parameters between wild-type and knockout strains

Expected phenotypic parameters to analyze:

Developmental StageParameters to MeasureAnalytical Methods
AggregationTime to aggregation, stream formationTime-lapse microscopy
Mound formationMound size, cell densityQuantitative image analysis
Slug migrationDirectionality, speed, phototaxisTracking analysis
Fruiting bodyStalk/spore ratio, morphologyHistological staining, microscopy

Based on studies of other calcium-regulatory proteins in D. discoideum, disruption of calcium homeostasis typically affects chemotaxis, cell adhesion, and differentiation—all critical processes for proper multicellular development .

What is the relationship between TMCO1 function and the high prion-like protein content in D. discoideum?

D. discoideum has the highest content of prion-like proteins among all organisms investigated, suggesting a unique proteostatic environment . Given that calcium signaling affects protein folding and aggregation:

Research approaches:

  • Analyze whether TMCO1-mediated calcium regulation influences prion-like protein aggregation

  • Compare aggregation propensity of known prion-like proteins in wild-type versus TMCO1-deficient cells

  • Investigate potential co-localization of TMCO1 with stress granules or protein quality control machinery

  • Determine if calcium dysregulation exacerbates aggregation of heterologous prion proteins expressed in D. discoideum

D. discoideum has demonstrated unusual resilience to prion and prion-like protein aggregation compared to other organisms . Studies have shown that well-characterized prion-like proteins such as expanded polyglutamine (Q103) and the yeast Sup35 prion domain remain soluble in D. discoideum under normal conditions but aggregate under chaperone-compromising conditions . This suggests sophisticated proteostatic mechanisms that may involve calcium homeostasis regulated by proteins like TMCO1.

How does the structure of D. discoideum TMCO1 compare to human TMCO1 and other Oxa1 superfamily members?

The Oxa1 superfamily, which includes TMCO1, shares a conserved structural core while displaying functional specialization across members:

Structural comparison methodology:

  • Generate structural models using homology modeling and AlphaFold predictions

  • Compare transmembrane topology using hydropathy analysis and membrane insertion predictions

  • Analyze conservation of key functional residues involved in calcium sensing and pore formation

  • Investigate differences in cytoplasmic domains that may interact with species-specific binding partners

Key structural features of TMCO1 and related proteins:

ProteinCore TMHsCytoplasmic HairpinSpecies DistributionPrimary Function
TMCO13PresentEukaryotesCa2+ homeostasis
YidC3PresentBacteria, ArchaeaMembrane protein insertion
EMC33Present (elongated)EukaryotesMembrane protein insertion
GET13Present (modified)EukaryotesTail-anchored protein insertion

Structural analysis reveals that while the core transmembrane regions are conserved, the H2/3 hairpin region shows significant variation among Oxa1 family members. In YidC and TMCO1, this forms a relatively compact cytosolic hairpin, while it is markedly elongated in GET1 and tethered via long flexible loops in EMC3 .

What is the molecular mechanism of TMCO1-mediated calcium release in D. discoideum?

Understanding the precise mechanism of TMCO1 channel formation and calcium flux requires detailed structural and functional studies:

Research approaches:

  • Identify calcium-sensing residues through site-directed mutagenesis

  • Determine the stoichiometry of channel assembly using cross-linking and mass spectrometry

  • Map the ion conduction pathway using cysteine accessibility methods

  • Characterize channel gating mechanisms through electrophysiological recordings

The human TMCO1 forms tetrameric channels when ER calcium levels are elevated . This assembly allows excess calcium to flow from the ER into the cytoplasm, preventing calcium overload. Studies with TMCO1 knockdown in other cell types have shown increased intracellular calcium levels, suggesting impaired calcium homeostasis .

How can D. discoideum TMCO1 be used as a model for understanding human TMCO1-related diseases?

Mutations in human TMCO1 are associated with cerebro-facio-thoracic dysplasia and primary open-angle glaucoma . D. discoideum provides a simplified system to study these disease mechanisms:

Research strategies:

  • Introduce disease-associated mutations into D. discoideum TMCO1 using CRISPR-Cas9

  • Characterize calcium homeostasis defects in mutant strains

  • Assess developmental phenotypes as potential correlates to human disease manifestations

  • Screen for genetic and pharmacological suppressors of TMCO1 mutant phenotypes

D. discoideum has proven valuable as a model for neurological disorders by allowing the investigation of conserved cellular functions in a simplified system . While D. discoideum lacks the complexity of human tissues affected in TMCO1-related disorders, fundamental cellular processes like calcium homeostasis, ER stress responses, and apoptosis are conserved and can be studied mechanistically.

What methods are most effective for investigating TMCO1's role in apoptosis and cell survival in D. discoideum?

Studies in other cell types have shown that TMCO1 knockdown affects cell activity and apoptosis by modulating expression of apoptotic regulators like Bcl-2, caspase-3, and caspase-9 :

Research approaches:

  • Monitor cell viability and growth curves in wild-type versus TMCO1-deficient D. discoideum

  • Measure expression of apoptosis-related proteins under normal and stress conditions

  • Assess mitochondrial function and membrane potential as indicators of apoptotic processes

  • Analyze calcium-dependent signaling pathways that link ER calcium release to apoptotic decisions

Apoptotic markers to evaluate:

MarkerFunctionMeasurement MethodExpected Change in TMCO1 Deficiency
Bcl-2 homologsAnti-apoptoticWestern blot, qPCRDecreased expression
Caspase-like proteasesApoptotic executionActivity assays, Western blotIncreased activation
Phosphatidylserine exposureMembrane rearrangementAnnexin V stainingIncreased exposure
Mitochondrial membrane potentialEnergetic statusTMRM or JC-1 stainingDecreased potential

Research in A549 cells has shown that TMCO1 knockdown decreases cell activity and affects apoptosis by decreasing Bcl-2 expression while increasing caspase-3 and caspase-9 expression levels . Similar mechanisms may operate in D. discoideum, making it a valuable model to study the evolutionary conservation of calcium-mediated apoptotic pathways.

What are the common pitfalls in generating stable D. discoideum TMCO1 knockout or knockdown lines?

Creating gene-modified D. discoideum strains for TMCO1 studies presents several technical challenges:

Methodological solutions:

  • For knockout generation:

    • Design multiple guide RNAs targeting different exons when using CRISPR-Cas9

    • Include selection markers flanked by loxP sites for marker recycling in sequential modifications

    • Verify knockouts by genomic PCR, RT-PCR, and Western blotting to confirm complete elimination

  • For RNAi-mediated knockdown:

    • Use inducible promoters to control knockdown timing if TMCO1 is essential

    • Design multiple non-overlapping RNAi constructs to control for off-target effects

    • Quantify knockdown efficiency using qRT-PCR and Western blotting

  • For phenotypic analysis:

    • Include rescue experiments with wild-type TMCO1 to confirm specificity

    • Monitor calcium homeostasis as a functional readout of TMCO1 activity

    • Consider genetic background effects by generating knockouts in multiple D. discoideum strains

How can researchers effectively distinguish between direct and indirect effects of TMCO1 manipulation on calcium signaling?

Given calcium's role as a ubiquitous second messenger, distinguishing direct TMCO1 effects from downstream consequences requires careful experimental design:

Research strategies:

  • Use acute inhibition techniques (e.g., optogenetics, chemical-genetic approaches) to observe immediate effects

  • Employ calcium chelators and ionophores to manipulate calcium levels independently of TMCO1

  • Develop temporally controlled gene expression systems to observe immediate versus long-term consequences

  • Utilize subcellular calcium sensors to track compartment-specific calcium dynamics

When knocking down TMCO1, researchers should be aware that the observed elevated intracellular calcium concentration may trigger numerous secondary effects through calcium-dependent signaling pathways. Time-course experiments and careful controls are essential to distinguish primary from secondary phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.