Recombinant Dictyostelium discoideum Transmembrane protein 111 homolog (tmem111)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
emc3; tmem111; DDB_G0278153; ER membrane protein complex subunit 3; Transmembrane protein 111
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
emc3
Target Protein Sequence
MTESPIVLDVEIRNWVVIPILIVLFIVSALKLNISRIMQINSGKPQDVEKTMQMQTINRV RRLVSFYNRIPQKSFFIRKAYLCGTTGSKTNKGILSSIAPTQEDSNPMNMMFANSMFTDP SGITDMLKGNIMHLIPQVTMMSWVNHFFSGFVACKLPFFPLTIRFKTFLQRGIEMGSLDV SYVSSLSWYFLCWFGSEGINAILLGENMVSADSQLLQSSIEPGPPTQQTPIHKIYASEKE NIEMIRYDSLMTNIEDRFLDNIKKKTSFDFNQINKNNNNNNNNTSNIKPKPIKSNLSNSK QSKRITYQKPSSLI
Uniprot No.

Target Background

Function
This protein is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum membrane. It exhibits a preference for proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. It's involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. Furthermore, it's essential for the post-translational insertion of tail-anchored (TA) proteins into the endoplasmic reticulum membrane. By mediating the proper co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), it controls the topology of multi-pass membrane proteins. Through its regulation of protein membrane insertion, it indirectly participates in numerous cellular processes.
Database Links
Protein Families
EMC3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Dictyostelium discoideum tmem111 protein and what is its primary function?

Dictyostelium discoideum tmem111 is a homolog of the mammalian transmembrane protein 111, which functions as part of the endoplasmic reticulum (ER) membrane protein complex (EMC). This complex plays a critical role in membrane protein biogenesis, particularly facilitating energy-independent insertion of nascent membrane proteins into the ER, especially those with weakly hydrophobic or destabilizing transmembrane domains. In D. discoideum, homologs of human ER-associated proteins, including tmem111, are implicated in chemotactic signaling and multicellular development processes .

What is the structural composition of recombinant tmem111?

The recombinant protein typically consists of:

  • Amino Acid Sequence: Partial sequence spanning residues 1–314 (UniProt: Q54YN3), excluding the full C-terminal domain

  • Key Domains: Contains a transmembrane domain critical for ER membrane integration

  • Modifications: Often fused with N-terminal His tags for affinity purification in recombinant versions

How was tmem111 identified in Dictyostelium discoideum?

Tmem111 was identified through gene coexpression network analyses. As reported in a study published in 2009, researchers analyzing gene networks based on natural variation in human gene expression also identified corresponding homologs in model organisms. They specifically noted TMEM111 as a poorly characterized gene that was predicted and subsequently confirmed to be part of the endoplasmic reticulum-associated secretory pathway . The D. discoideum homolog was later characterized through comparative genomic approaches and experimental validation.

What expression systems are optimal for producing recombinant tmem111?

Recombinant D. discoideum tmem111 can be produced in multiple expression systems, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coli- High yield
- Cost-effective
- Rapid production
- May form inclusion bodies
- Limited post-translational modifications
Yeast- Eukaryotic post-translational modifications
- Proper protein folding
- Lower yield than E. coli
- Longer production time
Baculovirus/Insect cells- Advanced eukaryotic post-translational modifications
- Suitable for membrane proteins
- Higher cost
- More complex methodology
Mammalian cell systems- Most authentic post-translational modifications
- Proper folding of complex proteins
- Highest cost
- Lowest yield
- Most time-consuming

The choice depends on research requirements for protein authenticity versus yield .

What purification strategies are most effective for recombinant tmem111?

An effective purification protocol for recombinant tmem111 typically involves:

  • Affinity Chromatography: Using His-tagged constructs and nickel or cobalt affinity columns. The N-terminal His tag commonly used for tmem111 allows for efficient single-step purification.

  • Buffer Optimization: Tris-based buffers with 50% glycerol provide stability for tmem111 during storage at -20°C.

  • Quality Control: Assessing purity using SDS-PAGE with a target of ≥85% purity as standard for research applications .

This approach can be supplemented with size exclusion chromatography for higher purity requirements for structural studies.

How can researchers utilize recombinant tmem111 in studies of ER membrane protein biogenesis?

Recombinant tmem111 serves as a valuable tool for studying ER membrane protein biogenesis through:

  • In vitro reconstitution assays: Using purified recombinant tmem111 with other EMC components to study the mechanism of membrane protein insertion into artificial liposomes.

  • Protein-protein interaction studies: Employing tagged recombinant tmem111 to identify binding partners within the EMC complex and with client proteins.

  • Structure-function analyses: The partial recombinant construct (residues 1-314) allows for domain-specific studies of tmem111 function, particularly focusing on the transmembrane domain critical for ER membrane integration.

  • Comparative studies: Using D. discoideum tmem111 alongside homologs from other species to determine evolutionarily conserved mechanisms of membrane protein biogenesis.

How does tmem111 function relate to D. discoideum development and multicellular organization?

Research indicates that homologs of human ER-associated proteins, including tmem111, play important roles in D. discoideum development:

  • Chemotactic signaling: ER membrane proteins are implicated in the signaling pathways that regulate D. discoideum chemotaxis, essential for multicellular development .

  • Vesicular transport: As part of the ER membrane complex, tmem111 may contribute to proper protein trafficking needed during developmental transitions from single-cell to multicellular forms .

  • Calcium signaling: Studies on D. discoideum have shown that proteins involved in ER function can regulate calcium signaling, which is critical during aggregation and development .

Understanding these functions is facilitated by gene expression studies throughout D. discoideum's developmental stages, similar to approaches used for other genes in this organism .

What methodologies are most effective for studying tmem111 expression patterns during D. discoideum development?

Several complementary approaches can be employed:

  • RT-PCR and qRT-PCR: For semi-quantitative and quantitative analysis of tmem111 expression at different developmental time points. This approach has been successfully used to track gene expression in D. discoideum during development from vegetative growth through multicellular stages .

  • RNA-Seq: For genome-wide expression profiling, allowing comparison of tmem111 with other genes during development. Protocols similar to those used in transcriptional response studies can be adapted for developmental analysis .

  • Reporter gene constructs: Creating tmem111 promoter-reporter fusions to visualize expression patterns in vivo during development.

  • Western blotting with recombinant antibodies: Using specific antibodies against tmem111 to track protein levels. The availability of recombinant antibody technologies for D. discoideum facilitates this approach .

How can genetic manipulation techniques be applied to study tmem111 function in D. discoideum?

Several established genetic approaches are applicable:

  • REMI mutagenesis: Restriction Enzyme-Mediated Integration can be used to generate tmem111 mutants, as has been done for studying other genes like AprA in D. discoideum .

  • Antisense RNA inhibition: A strategy successfully employed for mucolipin studies in D. discoideum can be adapted for tmem111. This approach involves cloning gene fragments in an antisense orientation to reduce expression levels .

  • Overexpression systems: Using vectors like pA15GFP for overexpression studies, similar to approaches used for other D. discoideum transmembrane proteins .

  • Gene replacement: Homologous recombination-based approaches to create precise mutations or deletions in the tmem111 gene.

The experimental design should include appropriate controls and validation of expression changes through qRT-PCR and Western blotting.

How might tmem111 function intersect with extracellular vesicle (EV) formation in D. discoideum?

This question represents a frontier in D. discoideum research. Current evidence suggests:

  • ER-EV connection: As an ER membrane protein, tmem111 may influence protein cargo sorting into EVs, which are known to be important mediators of intercellular communication in D. discoideum .

  • Developmental regulation: D. discoideum EVs have different molecular compositions during growth versus aggregation phases, suggesting developmental regulation that may involve ER proteins like tmem111 .

  • Research approaches:

    • Comparative proteomics of EVs from wild-type versus tmem111-altered D. discoideum cells

    • Tracking fluorescently tagged tmem111 to determine if it localizes to EVs or influences their formation

    • Analysis of EV production rates and composition in tmem111 mutants

This research direction could reveal novel functions of tmem111 beyond its known role in the ER membrane complex.

What are common challenges in working with recombinant tmem111 and how can they be addressed?

Common challenges and solutions include:

ChallengeSolution Strategies
Poor expression yield- Optimize codon usage for the expression system
- Test different promoters
- Evaluate expression at lower temperatures
- Consider using partial constructs (like the established 1-314 residue construct)
Protein insolubility- Include appropriate detergents for membrane protein solubilization
- Test various detergent types and concentrations
- Consider fusion with solubility-enhancing tags
- Use mild solubilization conditions
Protein instability- Store in optimized buffer conditions (Tris buffer with 50% glycerol at -20°C)
- Add protease inhibitors during purification
- Minimize freeze-thaw cycles
- Consider stabilizing additives like glycerol or specific ions
Protein aggregation- Perform size exclusion chromatography immediately before use
- Filter solutions through 0.1-0.22 μm filters
- Maintain appropriate protein concentration
- Add non-ionic detergents below critical micelle concentration

How can functional assays be designed to assess tmem111 activity in vitro and in vivo?

In vitro functional assays:

  • Membrane insertion assays: Using reconstituted liposomes to measure the ability of purified tmem111 to facilitate insertion of model transmembrane proteins.

  • Protein-protein interaction studies: Employing techniques like surface plasmon resonance, pull-down assays, or FRET to identify and characterize interactions between tmem111 and other components of the ER membrane complex or client proteins.

  • Structural studies: Using the recombinant protein for crystallography or cryo-EM to determine structural features important for function.

In vivo functional assays:

  • Phenotypic analysis of tmem111 mutants: Examining growth rates, developmental progression, and formation of multicellular structures in D. discoideum strains with altered tmem111 expression, similar to approaches used for other transmembrane proteins .

  • Cell biological assays: Investigating the impact of tmem111 alterations on ER morphology, protein trafficking, and stress responses.

  • Chemotaxis assays: Assessing whether tmem111 mutations affect directional cell movement in response to cAMP or folate, which are critical processes in D. discoideum biology .

These methodological approaches provide a comprehensive framework for investigating the biology of tmem111 in D. discoideum, from basic characterization to advanced functional studies.

How does D. discoideum tmem111 compare to its homologs in other organisms?

Comparative analysis of tmem111 across species reveals important evolutionary insights:

The tmem111 protein (also known as EMC3 in many organisms) is highly conserved across eukaryotes, suggesting fundamental roles in cellular function. In humans and other mammals, it functions as the ER membrane complex subunit 3 (EMC3) . Cross-species comparison shows:

  • Conservation level: While maintaining core functional domains, D. discoideum tmem111 shows moderate sequence identity with human EMC3/TMEM111, reflecting evolutionary divergence while preserving essential functions .

  • Domain structure: The transmembrane domain organization is conserved across species, emphasizing its critical role in ER membrane integration functions.

  • Functional studies methodology:

    • Complementation assays to determine if D. discoideum tmem111 can rescue phenotypes in yeast or mammalian cell EMC3/TMEM111 mutants

    • Comparative structural analysis to identify conserved functional surfaces

    • Evolutionary rate analysis to identify domains under purifying selection

This evolutionary context helps predict which functional aspects of tmem111 discovered in D. discoideum may be applicable to human biology.

What emerging technologies could advance our understanding of tmem111 function?

Several cutting-edge approaches hold promise for tmem111 research:

  • CRISPR-Cas9 genome editing: For precise modification of the tmem111 gene to create specific mutations or tagged variants in D. discoideum.

  • Single-cell RNA-seq: To reveal cell-type specific expression patterns of tmem111 during development, particularly during the transition from unicellular to multicellular stages.

  • Proximity labeling proteomics: Using BioID or APEX2 fusions with tmem111 to identify proximal proteins in living cells, providing insights into its functional partners in the ER membrane.

  • Cryo-electron tomography: For visualizing the native organization of tmem111 within the ER membrane complex in situ.

  • High-content screening: Using tmem111 mutant cells to identify chemical or genetic modifiers of its function, potentially revealing new therapeutic approaches for diseases related to ER membrane protein biogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.