Recombinant Dictyostelium discoideum Transmembrane protein 120 homolog (tmem120)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem120; DDB_G0288699; Transmembrane protein 120 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmem120
Target Protein Sequence
MMESFSETKSSIATNKSTTPTHEVQISKELQDIKNEVFELKKSHEQCKEKGIKVKKDIND VFKHADDITNTLAKHEKESSQLISRIKHLNAKEKQLDITKELSAHLDQIKVNVKRAKVSF TPETGSIFVRLFLGQVNVKHMRENEKFRLKQEYEKFKKKTNPQFILFVVLLLLYPQSSFV TTSWQIWLLYYYITLALRENILLVNGSSIKPWWIMHHYLSIAGSLTNLLFPLSESFSYFL PQVTYFSGCQGLVQILTNRYQQGRLYKLVAMGKANIIDVTGESEGWGNDPGWTPSALFLF PFLLFVQFFQLYNSFSFFAFAYQRSGYVEWQVFSCGFIFLCLGLGNLLTTLSVYYQKWKN FSKYNKEN
Uniprot No.

Target Background

Database Links
Protein Families
TMEM120 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Dictyostelium discoideum a suitable model for studying transmembrane proteins?

Dictyostelium discoideum offers several advantages as a model system for transmembrane protein research. Its fully sequenced genome has low redundancy, providing a less complex system while maintaining many genes and signaling pathways found in more complex eukaryotes . The haploid genome allows researchers to introduce single or multiple gene disruptions with relative ease, enabling the study of gene function in a true multicellular organism with measurable phenotypic outcomes . Additionally, D. discoideum's life cycle includes both unicellular and multicellular phases that occur within a short timeframe (approximately 24 hours), facilitating rapid phenotype detection . For transmembrane protein research specifically, D. discoideum has been valuable due to the availability of various expression constructs that enable studies on protein localization and function .

What are the basic tools needed to begin working with recombinant transmembrane proteins in Dictyostelium?

To begin working with recombinant transmembrane proteins in Dictyostelium, researchers need a foundational toolkit including:

  • Expression vectors optimized for D. discoideum, which are available through various research repositories

  • Antibodies for protein detection and characterization - recombinant antibodies have been developed to address the limited commercial availability of traditional antibodies for D. discoideum research

  • Basic cell culture equipment for maintaining D. discoideum cultures (incubators set at 21°C, sterile culture vessels, appropriate growth media like HL5)

  • Molecular biology reagents for DNA manipulation and cloning

  • Immunofluorescence supplies for protein localization studies (glass coverslips, paraformaldehyde for fixation, appropriate permeabilization agents like methanol, and mounting media like Möwiol with DABCO)

  • Imaging equipment such as confocal microscopes for visualizing transmembrane protein localization

This toolkit provides the foundation necessary for initial characterization of transmembrane proteins in this model organism.

How does the development of recombinant antibodies benefit research on D. discoideum transmembrane proteins?

The development of recombinant antibodies has significantly benefited D. discoideum research, particularly for transmembrane protein studies. Due to the relatively small size of the Dictyostelium research community, commercial vendors rarely produce antibodies targeting D. discoideum proteins, creating challenges in obtaining reliable detection reagents . Many of the mono- and polyclonal antibodies previously developed for D. discoideum antigens date back to the 1980s and represent finite resources; some have already been lost permanently .

Recombinant antibodies (rAbs) address these limitations by providing:

  • Renewable resources that can be produced consistently once sequenced

  • Accessibility to the entire Dictyostelium research community

  • Reliable tools for labeling and characterizing proteins and subcellular compartments

  • Preservation of valuable antibody specificities through hybridoma sequencing

  • Expansion of available antibody targets through phage display and other modern antibody discovery techniques

These advantages are particularly valuable for transmembrane protein research, where specific and consistent antibody reagents are essential for studying protein localization, trafficking, and function.

What are the optimal expression systems for producing recombinant transmembrane proteins in D. discoideum?

For expressing recombinant transmembrane proteins in D. discoideum, researchers should consider several factors when selecting expression systems:

  • Vector Selection: Extrachromosomal vectors versus integrating vectors. Extrachromosomal vectors typically provide higher expression levels but may show greater cell-to-cell variability. Integrating vectors offer more stable expression but potentially at lower levels .

  • Promoter Selection: The actin 15 promoter is commonly used for strong constitutive expression, while the discoidin promoter provides developmentally regulated expression. For transmembrane proteins that may be toxic when overexpressed, inducible promoters like the tetracycline-controlled promoter system may be optimal .

  • Fusion Tags: Consider the impact of tags on transmembrane protein folding and function. C-terminal tags are often preferable for transmembrane proteins to avoid interfering with signal peptides or N-terminal domains critical for membrane insertion. Common options include:

    • GFP or other fluorescent proteins for localization studies

    • His, FLAG, or HA tags for purification and detection purposes

  • Expression Timing: For some transmembrane proteins, expression during specific developmental stages may be necessary to observe proper localization and function. The availability of various expression constructs enables precise timing of protein expression .

Researchers should ensure that expression constructs are validated through Western blotting and immunofluorescence to confirm that the recombinant transmembrane proteins are correctly expressed, processed, and localized.

How can CRISPR technology be applied to study TMEM120 function in D. discoideum?

CRISPR-based gene editing has become a valuable tool for studying protein function in D. discoideum, including transmembrane proteins like TMEM120. The application of this technology should follow these methodological considerations:

  • Guide RNA Design: Design guide RNAs targeting exonic regions of the tmem120 gene, preferably early exons to ensure complete disruption of the protein. Multiple guide RNAs should be designed to increase editing efficiency.

  • Delivery Method: Optimize electroporation parameters for introducing CRISPR components into D. discoideum cells. Typically, this involves delivering a plasmid expressing Cas9 and the guide RNA, along with a repair template if precise editing is desired .

  • Screening Strategy: Develop a robust screening protocol to identify successfully edited clones:

    • PCR-based screening followed by sequencing to confirm mutations

    • Western blotting using available antibodies to confirm protein disruption

    • Phenotypic screens based on predicted TMEM120 functions

  • Functional Validation: Perform complementation studies by re-expressing wild-type or mutant versions of TMEM120 to confirm that observed phenotypes are directly attributable to the loss of TMEM120.

  • Phenotypic Analysis: Assess multiple cellular processes where transmembrane proteins may function:

    • Membrane organization and integrity

    • Vesicular trafficking

    • Cell adhesion and motility

    • Response to environmental stressors

    • Developmental progression

This comprehensive approach allows researchers to definitively characterize the functional importance of TMEM120 in D. discoideum.

What are the challenges in purifying recombinant transmembrane proteins from D. discoideum and how can they be overcome?

Purifying recombinant transmembrane proteins from D. discoideum presents several challenges due to their hydrophobic nature and membrane integration. Methodological approaches to overcome these challenges include:

  • Solubilization Optimization:

    • Test multiple detergents (DDM, CHAPS, digitonin) at various concentrations

    • Evaluate detergent-to-protein ratios systematically

    • Consider native nanodiscs or amphipols for maintaining protein structure

  • Purification Strategy:

    • Implement two-step purification protocols combining affinity chromatography with size exclusion or ion exchange chromatography

    • Use mild elution conditions to preserve protein structure and function

    • Consider on-column detergent exchange during purification

  • Expression Enhancement:

    • Co-express with chaperones to improve folding and stability

    • Use D. discoideum strains optimized for recombinant protein expression

    • Implement temperature shifts during expression to allow proper membrane insertion

  • Functional Validation:

    • Develop activity assays compatible with detergent-solubilized proteins

    • Validate protein folding through circular dichroism or limited proteolysis

    • Confirm oligomeric state through analytical ultracentrifugation or native PAGE

By systematically addressing these challenges, researchers can establish reliable protocols for obtaining pure, functional transmembrane proteins from D. discoideum for structural and functional studies.

What immunofluorescence protocol is most effective for visualizing recombinant transmembrane proteins in D. discoideum?

For optimal visualization of recombinant transmembrane proteins in D. discoideum, the following detailed immunofluorescence protocol is recommended:

  • Cell Preparation:

    • Grow D. discoideum cells axenically at 21°C in HL5 medium

    • Allow 5 × 10^5 cells to settle on 22 × 22 mm glass coverslips for 90 minutes at room temperature

    • Fix with 4% paraformaldehyde in HL5 medium for 30 minutes

    • Block with PBS containing 40 mM ammonium chloride for 5 minutes

  • Permeabilization:

    • For transmembrane proteins, test both methanol permeabilization (2 minutes at -20°C) and detergent-based permeabilization (0.1% Triton X-100 for 5 minutes) as different transmembrane proteins may require different approaches

    • Wash once with PBS (5 minutes)

    • Incubate for 15 minutes in PBS + 0.2% BSA (PBS-BSA)

  • Antibody Incubation:

    • Incubate with primary antibodies (recombinant scFv-Fc antibodies) for 30 minutes

    • For co-labeling experiments, combine recombinant antibodies with other primary antibodies in the same incubation

    • Wash extensively (three washes: 5, 5, and 15 minutes) with PBS-BSA

    • Incubate with appropriate secondary antibodies (e.g., anti-rabbit IgG conjugated to AlexaFluor-647, 1:300 dilution) for 30 minutes

    • Wash thoroughly (three washes: 5, 5, and 15 minutes) with PBS-BSA followed by a 5-minute wash with PBS

  • Mounting and Imaging:

    • Mount coverslips on slides using Möwiol + 2.5% DABCO to prevent photobleaching

    • Image using confocal microscopy with appropriate magnification (63× oil immersion objective recommended)

    • Collect Z-stack images to fully capture membrane localization patterns

  • Controls:

    • Include samples expressing fluorescent protein-tagged versions of the transmembrane protein for validation

    • Perform antibody specificity controls using knockout cells or peptide competition assays

This protocol has been successfully used for various D. discoideum antigens and can be adapted specifically for transmembrane protein visualization.

How can researchers optimize Western blot protocols for detecting recombinant transmembrane proteins from D. discoideum?

Transmembrane proteins present unique challenges for Western blot detection due to their hydrophobicity and tendency to aggregate during sample preparation. The following optimized protocol addresses these challenges for D. discoideum samples:

  • Sample Preparation:

    • Harvest 1-5 × 10^6 D. discoideum cells and wash twice in cold PBS

    • Add lysis buffer containing appropriate detergents (1% DDM or 1% digitonin often work well for transmembrane proteins)

    • Include protease inhibitors and maintain samples at 4°C throughout processing

    • Avoid boiling samples; instead, incubate at 37°C for 30 minutes to prevent aggregation

    • Centrifuge at 14,000×g for 10 minutes to remove insoluble material

  • Gel Selection and Running Conditions:

    • Use gradient gels (4-12% or 4-20%) to accommodate various molecular weights

    • Consider using specialized gel systems designed for membrane proteins

    • Run at lower voltage (80-100V) to prevent overheating and protein denaturation

  • Transfer Optimization:

    • Implement wet transfer methods rather than semi-dry for transmembrane proteins

    • Use transfer buffers containing 20% methanol and 0.05% SDS to facilitate transfer

    • Transfer at low amperage (200-300 mA) overnight at 4°C for efficient transfer

  • Blocking and Antibody Incubation:

    • Block membranes with 5% non-fat dry milk or 3% BSA in TBST for 1 hour

    • Dilute primary antibodies in blocking buffer and incubate overnight at 4°C

    • Wash extensively (4 × 10 minutes) with TBST

    • Incubate with appropriate secondary antibodies for 1 hour at room temperature

    • Wash extensively (4 × 10 minutes) with TBST

  • Detection Considerations:

    • Use enhanced chemiluminescence for standard detection

    • Consider near-infrared fluorescent detection systems for higher sensitivity and quantification capabilities

    • For poorly expressed transmembrane proteins, implement signal enhancement systems

By following this optimized protocol, researchers can improve detection sensitivity and specificity for recombinant transmembrane proteins from D. discoideum samples.

What approaches can be used to assess the functional activity of recombinant TMEM120 in D. discoideum?

Assessing the functional activity of recombinant TMEM120 in D. discoideum requires multiple complementary approaches:

  • Localization Studies:

    • Perform immunofluorescence using antibodies against TMEM120 or fluorescent protein fusions to determine subcellular localization

    • Conduct co-localization studies with markers for specific cellular compartments to identify where TMEM120 functions

    • Implement live-cell imaging to track dynamic changes in localization during different cellular processes

  • Phenotypic Analysis of Knockout/Overexpression Strains:

    • Generate TMEM120 knockout strains using CRISPR-based gene editing

    • Create strains overexpressing wild-type or mutant versions of TMEM120

    • Assess multiple phenotypes including:

      • Growth rates in liquid culture

      • Development on non-nutrient agar

      • Cell morphology and cytoskeleton organization

      • Response to different environmental stressors

  • Protein-Protein Interaction Studies:

    • Conduct co-immunoprecipitation experiments to identify interaction partners

    • Perform proximity labeling (BioID or APEX) to identify proteins in close proximity to TMEM120

    • Validate interactions using reciprocal co-immunoprecipitation or fluorescence resonance energy transfer (FRET)

  • Functional Rescue Experiments:

    • Complement knockout strains with wild-type TMEM120 to verify phenotype rescue

    • Test structure-function relationships by complementing with mutated versions of TMEM120

    • Assess cross-species functionality by expressing human TMEM120 orthologs

  • Physiological Measurements:

    • Monitor membrane potential or ion flux if TMEM120 is predicted to function as an ion channel

    • Assess lipid composition and membrane organization if TMEM120 is involved in lipid metabolism

    • Measure cellular responses to specific stimuli based on predicted TMEM120 function

These multifaceted approaches provide comprehensive insights into TMEM120 function in D. discoideum.

How should researchers interpret discrepancies between localization patterns of recombinant TMEM120 and its mammalian homologs?

When researchers encounter discrepancies between localization patterns of recombinant TMEM120 in D. discoideum and its mammalian homologs, the following analytical framework can guide interpretation:

  • Methodological Considerations:

    • Evaluate whether differences could be attributed to experimental approaches (fixation methods, antibody specificity, expression levels)

    • Compare subcellular fractionation results with imaging data to confirm localization patterns

    • Assess whether protein tags might influence localization differently in different systems

  • Evolutionary Context:

    • Consider that transmembrane proteins may have evolved different functions or regulatory mechanisms across species

    • Analyze protein domain architecture to identify conserved and divergent regions that might explain localization differences

    • Examine whether post-translational modifications differ between D. discoideum and mammalian TMEM120

  • Functional Validation:

    • Test whether heterologous expression of mammalian TMEM120 in D. discoideum results in similar localization to the endogenous protein

    • Assess whether the D. discoideum TMEM120 can functionally complement mammalian cells lacking the homologous protein

    • Identify interacting partners in both systems to determine if interaction networks have diverged

  • Physiological Relevance:

    • Determine whether localization differences correlate with functional differences

    • Consider cell type-specific or condition-dependent localization in mammalian systems versus the relatively simpler D. discoideum

    • Assess whether developmental stage affects localization patterns in both systems

By systematically analyzing these factors, researchers can determine whether localization differences represent true biological divergence or experimental artifacts, and leverage these insights to better understand TMEM120 function across evolution.

What statistical approaches are most appropriate for analyzing quantitative data from D. discoideum TMEM120 studies?

For quantitative analysis of D. discoideum TMEM120 studies, the following statistical approaches are recommended:

  • For Localization Quantification:

    • Pearson's correlation coefficient for co-localization analysis

    • Manders' overlap coefficient for partial co-localization assessment

    • Object-based co-localization analysis for discrete structures

    • Sample size: Analyze ≥30 cells across ≥3 independent experiments

  • For Expression Level Comparisons:

    • Western blot quantification using appropriate normalization controls

    • qRT-PCR with validated reference genes for mRNA quantification

    • Statistical tests: Student's t-test for two-condition comparisons or ANOVA with post-hoc tests for multiple conditions

    • Report fold-changes with 95% confidence intervals

  • For Phenotypic Analyses:

    • Growth curves: Calculate doubling times and compare using non-linear regression models

    • Development: Quantify timing of developmental stages and morphological parameters

    • Motility: Track cell movement using automated image analysis (speed, directionality, persistence)

    • Statistical approach: Mixed-effects models to account for experimental variation

  • For Protein-Protein Interaction Studies:

    • Implement statistical filtering of mass spectrometry data using tools like SAINT or CRAPome

    • Calculate enrichment scores relative to appropriate controls

    • Perform cluster analysis to identify functional groups among interacting proteins

  • Data Visualization:

    • Use box plots or violin plots rather than bar graphs to show data distribution

    • Include individual data points to demonstrate sample variability

    • Implement heat maps for multi-parameter data sets

    • Create standardized data visualization formats for comparing mutants and conditions

This comprehensive statistical framework ensures robust analysis and interpretation of quantitative data from D. discoideum TMEM120 studies.

How can researchers effectively compare function and structure between D. discoideum TMEM120 and mammalian TMEM120 proteins?

Effectively comparing D. discoideum TMEM120 with mammalian homologs requires a multifaceted approach integrating structural and functional analyses:

  • Sequence-Based Structural Comparisons:

    • Perform multiple sequence alignments to identify conserved domains and motifs

    • Use hydropathy plot analysis to compare predicted transmembrane domains

    • Implement homology modeling based on available structural data

    • Generate the following comparative table:

    FeatureD. discoideum TMEM120Human TMEM120AHuman TMEM120B
    Length (amino acids)[value][value][value]
    Transmembrane domains[number][number][number]
    Conserved motifs[list][list][list]
    Post-translational modifications[list][list][list]
    Sequence identity100%[%][%]
    Sequence similarity100%[%][%]
  • Functional Conservation Testing:

    • Express mammalian TMEM120 in D. discoideum TMEM120-knockout strains to assess functional complementation

    • Create chimeric proteins swapping domains between D. discoideum and mammalian TMEM120 to identify functionally critical regions

    • Compare subcellular localization patterns using standardized experimental conditions

    • Assess interaction partner conservation through comparative proteomics

  • Pathway Integration Analysis:

    • Map TMEM120-associated pathways in both systems

    • Identify conserved and divergent regulatory mechanisms

    • Compare phenotypic outcomes of TMEM120 disruption

    • Analyze expression patterns during development or in response to stimuli

  • Structural Biology Approaches:

    • Where feasible, pursue structural studies (X-ray crystallography, cryo-EM) of both proteins

    • Compare structural features directly rather than relying solely on sequence-based predictions

    • Identify structural elements that might explain functional differences

This integrated approach provides comprehensive insights into evolutionary conservation and divergence of TMEM120 structure and function between D. discoideum and mammalian systems.

How can D. discoideum TMEM120 studies inform understanding of human disease mechanisms?

D. discoideum TMEM120 studies can provide valuable insights into human disease mechanisms through several approaches:

  • Functional Conservation Analysis:

    • Determine whether D. discoideum TMEM120 functions in pathways relevant to human diseases

    • Identify whether disease-associated mutations in human TMEM120 affect conserved residues or domains

    • Test whether expression of human disease variants in D. discoideum TMEM120-knockout strains produces informative phenotypes

  • Disease Modeling:

    • Generate D. discoideum cells expressing TMEM120 variants corresponding to human disease mutations

    • Assess cellular phenotypes related to known disease pathologies

    • Screen for small molecules that rescue mutant phenotypes as potential therapeutic leads

  • Pathway Discovery:

    • Use the genetic tractability of D. discoideum to perform unbiased screens for genetic interactors of TMEM120

    • Identify novel components of TMEM120-dependent pathways that may represent unrecognized disease factors

    • Validate findings in mammalian systems to confirm relevance to human disease

  • Drug Target Validation:

    • Test compounds targeting TMEM120 or associated pathways in D. discoideum

    • Use insertional mutant libraries to facilitate pharmacogenetic screens

    • Identify off-target effects and potential combination therapies

D. discoideum offers significant advantages for these studies, including rapid generation of mutants, straightforward phenotypic analysis, and a simplified genetic background that facilitates interpretation of results . The conservation of many disease-related genes and pathways between D. discoideum and humans makes this model organism particularly valuable for translational research.

What are the key considerations for designing recombinant TMEM120 constructs for different experimental applications?

Designing recombinant TMEM120 constructs for different experimental applications requires careful consideration of multiple factors:

  • Expression Level Control:

    • For localization studies: Use moderate-strength promoters to avoid mislocalization due to overexpression

    • For biochemical purification: Use strong promoters (e.g., actin15) to maximize yield

    • For functional studies: Consider inducible promoters to control expression timing and level

  • Tag Selection and Placement:

    • For localization: Fluorescent protein tags (GFP, mCherry) with flexible linkers to minimize interference

    • For purification: Affinity tags (His, FLAG, TAP) positioned to avoid disrupting transmembrane domains

    • For interaction studies: BioID or APEX fusion proteins for proximity labeling

    • Tag position considerations:

    Tag PositionAdvantagesDisadvantagesBest Applications
    N-terminalLess likely to interfere with C-terminal interactionsMay disrupt signal sequencesProteins with known C-terminal functional domains
    C-terminalLess likely to interfere with membrane insertionMay disrupt C-terminal motifsProteins with known N-terminal functional domains
    Internal tagsMinimal disruption of terminal domainsComplex design; may affect protein foldingAdvanced structural studies with detailed domain information
  • Mutation Design:

    • Point mutations: Design based on sequence conservation analysis

    • Truncations: Create based on predicted domain boundaries

    • Domain swaps: Design junctions in non-structured regions between domains

  • Vector Selection:

    • For stable expression: Integrating vectors with selection markers

    • For transient expression: Extrachromosomal vectors with high copy number

    • For complex designs: Gateway-compatible vectors to facilitate construct generation

  • Control Constructs:

    • Design appropriate negative controls (inactive mutants)

    • Include positive controls (well-characterized transmembrane proteins)

    • Create matched expression level controls to account for expression artifacts

By systematically addressing these considerations, researchers can design optimal TMEM120 constructs for specific experimental objectives, enhancing the reliability and relevance of their findings.

How can advanced imaging techniques be applied to study D. discoideum TMEM120 dynamics and interactions?

Advanced imaging techniques offer powerful approaches for studying TMEM120 dynamics and interactions in D. discoideum:

  • Super-Resolution Microscopy:

    • Implement STED (Stimulated Emission Depletion) microscopy to resolve TMEM120 distribution within membrane subdomains

    • Apply PALM/STORM (Photoactivated Localization Microscopy/Stochastic Optical Reconstruction Microscopy) for nanoscale mapping of TMEM120 organization

    • Use structured illumination microscopy (SIM) for improved resolution in live cells

    • Protocol considerations:

      • Optimize sample preparation to minimize background fluorescence

      • Use appropriate fluorophores with photostability for super-resolution imaging

      • Implement drift correction for long acquisition times

  • Live-Cell Dynamics:

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to measure TMEM120 mobility within membranes

    • Implement photoactivatable/photoconvertible fluorescent protein fusions to track subpopulations of TMEM120

    • Use spinning disk confocal microscopy for high-speed imaging of rapid dynamics

    • Analytical approaches:

      • Calculate diffusion coefficients from FRAP recovery curves

      • Quantify directed movement versus random diffusion

      • Correlate dynamic changes with cellular events or stimuli

  • Protein-Protein Interaction Imaging:

    • Apply FRET (Förster Resonance Energy Transfer) to detect direct interactions between TMEM120 and partner proteins

    • Implement BiFC (Bimolecular Fluorescence Complementation) to visualize and confirm specific interactions

    • Use three-color imaging to simultaneously track TMEM120 and multiple interaction partners

    • Validation strategies:

      • Perform controls with known non-interacting proteins

      • Confirm interactions using complementary biochemical approaches

      • Test interaction disruption through targeted mutations

  • Correlative Light-Electron Microscopy (CLEM):

    • Combine fluorescence imaging with electron microscopy to correlate TMEM120 localization with ultrastructural features

    • Implement immunogold labeling with antibodies against TMEM120 for transmission electron microscopy

    • Use cryo-electron tomography for 3D visualization of TMEM120 in its native environment

These advanced imaging approaches, when combined with the genetic tractability of D. discoideum, provide unprecedented insights into TMEM120 function, dynamics, and interactions at multiple scales of resolution.

What are the current gaps in knowledge regarding D. discoideum TMEM120 that represent priorities for future research?

Despite advances in understanding transmembrane proteins in D. discoideum, several critical knowledge gaps regarding TMEM120 specifically represent priorities for future research:

  • Functional Characterization:

    • The precise biological function of TMEM120 in D. discoideum remains to be fully elucidated

    • The role of TMEM120 during different stages of the D. discoideum life cycle needs systematic investigation

    • Potential involvement in specific cellular processes like membrane organization, trafficking, or signaling requires clarification

  • Structural Information:

    • High-resolution structural data for TMEM120 is currently lacking

    • The topology and organization of transmembrane domains need experimental validation

    • Structural features that mediate protein-protein or protein-lipid interactions remain undefined

  • Regulatory Mechanisms:

    • Factors controlling TMEM120 expression, localization, and activity are poorly understood

    • Post-translational modifications and their functional implications have not been comprehensively mapped

    • Potential changes in TMEM120 function during development or in response to environmental stimuli remain to be characterized

  • Interaction Network:

    • The complete set of TMEM120 interaction partners is unknown

    • Integration of TMEM120 into broader cellular signaling networks requires further investigation

    • Evolutionary conservation of interaction partners between D. discoideum and mammalian systems needs systematic analysis

Addressing these gaps will require integrated approaches combining genetic, biochemical, structural, and cell biological methods, leveraging the experimental advantages of D. discoideum as a model system .

How can researchers contribute to improving the availability of tools for D. discoideum TMEM120 research?

Researchers can significantly improve the availability of tools for D. discoideum TMEM120 research through several strategic approaches:

  • Antibody Development and Sharing:

    • Generate and characterize recombinant antibodies against TMEM120 using phage display or hybridoma sequencing techniques

    • Validate antibodies thoroughly for multiple applications (immunofluorescence, Western blotting, immunoprecipitation)

    • Share antibody sequences and expression vectors through repositories and databases

    • Publish detailed validation data in resources like Antibody Reports

  • Genetic Tool Development:

    • Create and validate CRISPR/Cas9 guide RNAs specifically targeting the TMEM120 gene

    • Generate and characterize knockout cell lines and share them with the community

    • Develop conditional expression systems for TMEM120 functional studies

    • Establish reporter strains for monitoring TMEM120 expression and localization

  • Expression Construct Library:

    • Design a comprehensive set of TMEM120 expression constructs with various tags and promoters

    • Create mutation series targeting conserved residues or domains

    • Develop chimeric constructs between D. discoideum and mammalian TMEM120 homologs

    • Deposit constructs in community repositories with detailed validation data

  • Protocol Standardization and Sharing:

    • Develop and optimize protocols specifically for TMEM120 purification and analysis

    • Create detailed methodological publications focusing on technical aspects

    • Establish standard operating procedures for key TMEM120-related assays

    • Conduct workshops or training sessions at community meetings

  • Data Sharing and Integration:

    • Contribute TMEM120-related data to dictyBase and other community resources

    • Implement standardized data reporting formats to facilitate cross-study comparisons

    • Develop computational tools for analyzing TMEM120 sequence, structure, and function

    • Create accessible databases of TMEM120 interaction partners and phenotypes

These community-focused efforts would substantially enhance the accessibility and quality of tools for D. discoideum TMEM120 research, addressing the challenges currently faced by researchers in this field .

What collaborative research approaches could accelerate progress in understanding TMEM120 function across species?

Collaborative research approaches could significantly accelerate progress in understanding TMEM120 function across species through the following strategies:

  • Multi-Model Organism Consortium:

    • Establish a coordinated research network studying TMEM120 across D. discoideum, yeast, C. elegans, Drosophila, zebrafish, and mammalian systems

    • Implement standardized experimental approaches to facilitate cross-species comparisons

    • Develop a shared database for integrating phenotypic, interaction, and functional data

    • Coordinate regular virtual and in-person meetings for data sharing and collaboration planning

  • Integrated Methodological Approaches:

    • Combine complementary expertise in:

      • Structural biology (crystallography, cryo-EM, NMR)

      • Functional genomics (CRISPR screens, transcriptomics)

      • Proteomics (interaction mapping, post-translational modifications)

      • Cell biology (advanced imaging, phenotypic analysis)

      • Computational biology (structural modeling, evolutionary analysis)

    • Create standardized research protocols that can be applied across species

  • Translational Research Pipeline:

    • Design parallel experiments in D. discoideum and mammalian systems

    • Use D. discoideum for initial discovery and high-throughput screening

    • Validate and extend findings in mammalian models

    • Develop disease-relevant applications based on conserved mechanisms

    • Create a formalized pathway for translating discoveries between model systems

  • Resource Development and Sharing:

    • Generate species-specific antibodies with cross-validation

    • Create matched mutant cell lines across species

    • Develop comparable expression constructs for cross-species studies

    • Establish a centralized repository for TMEM120-related reagents

  • Coordinated Funding and Publication Strategy:

    • Pursue collaborative funding mechanisms specifically designed for multi-organism studies

    • Establish publication partnerships to create integrated stories across model systems

    • Develop community guidelines for data sharing and attribution

    • Organize special issues or research topics in journals focusing on TMEM120 biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.