Recombinant Dictyostelium discoideum Transmembrane protein 170 homolog (tmem170)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Dictyostelium discoideum Transmembrane protein 170 homolog (TMEM170) is a transmembrane protein that has gained attention for its role in various cellular processes and its potential as a prognostic biomarker in certain cancers . TMEM170 is found in multiple organisms, including humans, mice, and rats .

Basic Information

TMEM170, also known as transmembrane protein 170A in humans, is involved in endoplasmic reticulum (ER) and nuclear envelope morphogenesis . It influences the balance between tubular ER and ER sheets, favoring tubular ER formation .

Expression and Production

Recombinant TMEM170 can be produced in vitro using E. coli expression systems .

Role in Pancreatic Adenocarcinoma (PAAD)

TMEM170B is also involved in immune-related gene sets, affecting chemokine signaling pathways and innate and adaptive immunity . High TMEM170B expression is associated with an antitumor immune microenvironment, characterized by increased infiltration of B cells, T cells, dendritic cells, monocytes, M1 macrophages, neutrophils, and natural killer cells, along with reduced levels of Tregs and myeloid-derived suppressor cells .

p values < 0.05 were considered to denote statistical significance.

Clinical Significance in PAAD

Multivariate analysis identified TMEM170B expression as an independent prognostic factor for OS (HR = 0.12, 95% CI = 0.014–0.995, and p = 0.049) and DFS (HR 0.19, 95% CI 0.04–0.91; p = 0.038) .

Functional and Pathway Enrichment Analysis

Functional enrichment and GO analyses indicate that TMEM170B-related genes are involved in biological activities such as leukocyte migration, cell–cell adhesion mediator activity, ameboidal-type cell migration, and epithelial cell migration . KEGG pathway analysis highlights involvement in cytokine–cytokine receptor interaction, malaria, the IL-17 signaling pathway, and the p53 signaling pathway . GSEA-KEGG analysis further supports the involvement of cytokine–cytokine receptor interaction, chemokine signaling pathway, natural killer cell-mediated cytotoxicity, and T cell receptor signaling pathway . Reactome pathway analysis reveals significant enrichment in G protein-coupled receptor (GPCR) ligand binding, interleukin signaling, and platelet activation signaling and aggregation .

Immune Cell Infiltration

Correlation analysis demonstrates a relationship between TMEM170B expression and immune infiltration, with high TMEM170B expression associated with increased infiltration of antitumor immune cells and reduced infiltration of immunosuppressive cells .

TMEM170A in Human Cells

TMEM170A, the human homolog, is a transmembrane protein that localizes to all parts of the ER, including the nuclear envelope and tubular ER .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
tmem170; DDB_G0290053; Transmembrane protein 170 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmem170
Target Protein Sequence
MPFRDSLQPDTRYLTDGSLFHGYFYQYGDIWLAITFWCTVVTTISYLISGFVASFVLKKS KFSPFIPIFTAMYGMAIGICYGGISALILSAIYVSGSFLLSWYQGIICGVGLAIVHLLFA FTQGKLQV
Uniprot No.

Target Background

Database Links
Protein Families
TMEM170 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Dictyostelium discoideum a valuable model organism for research?

Dictyostelium discoideum offers exceptional value as a model organism due to its unique combination of attributes. It exhibits both unicellular and multicellular life stages, provides genetic and experimental tractability, and possesses numerous orthologs of human genes associated with neurological disorders . Its genome has been completely sequenced, enabling the identification of gene functions through various genetic manipulation techniques . Unlike other microbial models, Dictyostelium's distinctive lifecycle alternates between a solitary amoeboid phase and a social developmental phase, providing diverse phenotypic "readouts" of underlying cytopathological pathways . This makes it particularly useful for studying complex biochemical processes in a simplified system.

Additionally, Dictyostelium bridges an evolutionary gap between unicellular and multicellular organisms, providing insights applicable to both microbial pathogens like Entamoeba histolytica and higher organisms including humans . This evolutionary positioning allows researchers to study conserved cellular processes in a system that is more experimentally accessible than mammalian models.

How can researchers effectively express and purify recombinant Dictyostelium TMEM170?

Expression and purification of recombinant Dictyostelium TMEM170 can be achieved through the following methodology:

Expression System Selection:
E. coli has been successfully used to express the full-length Dictyostelium TMEM170 protein (amino acids 1-128) with an N-terminal His tag . This bacterial system provides efficient protein production for transmembrane proteins of this size.

Expression Protocol:

  • Clone the tmem170 gene into an expression vector with an N-terminal His-tag

  • Transform the construct into E. coli expression strains

  • Induce protein expression under optimized conditions (temperature, IPTG concentration)

  • Harvest cells and lyse under conditions that maintain protein structure

Purification Strategy:

  • Solubilize the membrane protein using appropriate detergents

  • Perform immobilized metal affinity chromatography (IMAC) using the His-tag

  • Include additional purification steps as needed (size exclusion, ion exchange)

  • Assess purity by SDS-PAGE (should exceed 90% as reported for commercially available preparations)

Post-Purification Handling:

  • Lyophilize the purified protein in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Store at -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

  • For reconstitution, briefly centrifuge to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

What genetic manipulation techniques are most effective for studying TMEM170 function in Dictyostelium?

Several genetic approaches have proven effective for studying proteins in Dictyostelium, which can be applied to TMEM170 research:

Restriction Enzyme-Mediated Integration (REMI):
REMI allows for creation of gene disruptions by integrating plasmid DNA into the Dictyostelium genome . This method has been widely used to identify gene functions through random insertional mutagenesis. The affected genes can be identified by extracting the plasmid from the genome and sequencing retained pieces of genomic DNA .

Chemical Mutagenesis:
N-methyl-N′-nitro-N-nitroguanidine (NTG) can be used to introduce mutations into the Dictyostelium genome, which can later be identified by whole-genome sequencing . This approach can achieve near genome-wide saturation of mutations.

Positive Selection Screens:
A novel screening pipeline coupling NTG mutagenesis with the 5-fluoroorotic acid counterselection system has been developed to enrich for mutations in genes of interest . This methodology significantly increases the efficiency of genetic screens in Dictyostelium.

Targeted Gene Knockout:
For specific functional studies of TMEM170, targeted gene knockout strategies can be employed. This approach has been successfully used for proteins such as gefA, AAA-ATPase, irlD, and torA in Dictyostelium .

Overexpression Systems:
Introducing additional copies of the tmem170 gene with expression-enhancing promoters can help determine the effects of increased protein levels. This approach was successfully employed with the BadA protein, where overexpression resulted in increased bacteriolytic activity in cell extracts .

What are the optimal storage and handling conditions for maintaining TMEM170 protein stability?

Maintaining the stability of recombinant TMEM170 protein requires careful attention to storage and handling conditions:

Storage Recommendations:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C/-80°C temperatures

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% (ideally 50%) final concentration for long-term storage

  • Avoid repeated freeze-thaw cycles which significantly reduce protein activity

Buffer Considerations:
Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been shown to maintain stability of the lyophilized protein . This buffer composition helps protect protein structure during freeze-thaw cycles.

Storage ConditionMaximum Storage TimeNotes
4°C (working solution)Up to 1 weekFor immediate experimental use
-20°C (with 50% glycerol)Several monthsAliquot to avoid freeze-thaw
-80°C (with 50% glycerol)Long-term storagePreferred for extended storage

What analytical methods are recommended for assessing TMEM170 purity and activity?

Multiple analytical approaches can be employed to evaluate the purity and functional activity of recombinant TMEM170:

Purity Assessment:

  • SDS-PAGE analysis - Commercial preparations typically achieve >90% purity as determined by SDS-PAGE

  • Size exclusion chromatography - To confirm monodispersity and absence of aggregates

  • Western blotting - Using antibodies against the His-tag or TMEM170-specific antibodies

  • Mass spectrometry - For precise molecular weight determination and confirmation of post-translational modifications

Structural Integrity:

  • Circular dichroism - To assess secondary structure content

  • Limited proteolysis - To verify proper folding

  • Thermal shift assays - To evaluate protein stability under different conditions

Functional Activity:
While specific assays for TMEM170 activity are not described in the provided literature, researchers could consider:

  • Membrane insertion assays - To verify proper folding and insertion capabilities

  • Protein-protein interaction studies - To identify binding partners

  • Cellular localization studies - Using fluorescently-tagged versions of the protein

These analytical approaches should be adapted based on the specific research questions being investigated and the hypothesized function of TMEM170 in Dictyostelium.

How can Dictyostelium TMEM170 be utilized in neurological disorder research?

Dictyostelium discoideum has emerged as a powerful model for studying neurological disorders . While the specific role of TMEM170 in neurological functions is not directly established in the provided literature, researchers can leverage several approaches to investigate potential connections:

Comparative Genomic Analysis:
Identify the human homologs of TMEM170 and determine whether these proteins have been implicated in neurological disorders. The Dictyostelium genome contains many orthologs of human genes associated with disorders including Alzheimer's disease, Parkinson's disease, Huntington's disease, neuronal ceroid lipofuscinoses, and lissencephaly .

Protein Interaction Networks:
Characterize the interaction partners of TMEM170 in Dictyostelium and determine whether any of these partners have human homologs involved in neurological functions. This could be accomplished through techniques such as co-immunoprecipitation followed by mass spectrometry analysis.

Expression in Disease Models:
Express human TMEM170 variants in Dictyostelium TMEM170-knockout cells to study their function. This approach has been successfully used with other human proteins: "human α-synuclein and Tau protein have been expressed singly and in combination in D. discoideum to elucidate the mechanisms of cellular toxicity in synucleinopathies and tauopathies" .

Polyglutamine Aggregation Studies:
Leverage Dictyostelium's extraordinary resistance to polyglutamine aggregation to investigate whether TMEM170 plays any role in protein folding or aggregation prevention. This could be particularly relevant if TMEM170 is found to interact with proteins involved in protein quality control pathways.

What role might TMEM170 play in Dictyostelium's unique resistance to protein aggregation?

Dictyostelium discoideum exhibits remarkable resistance to protein aggregation, particularly concerning polyglutamine-expanded proteins that typically aggregate in other organisms . Investigating TMEM170's potential role in this phenomenon presents an intriguing research direction:

Proteostasis Network Analysis:
Determine whether TMEM170 interacts with components of the cellular proteostasis network (chaperones, degradation machinery, etc.). This could be approached through:

  • Protein-protein interaction studies

  • Co-localization analyses

  • Genetic interaction screens

TMEM170 Knockout Effects:
Generate TMEM170 knockout strains and assess whether they exhibit altered sensitivity to protein aggregation challenges. This could involve:

  • Expressing aggregation-prone proteins (like polyQ-expanded huntingtin) in wild-type vs. TMEM170-knockout backgrounds

  • Measuring aggregation using fluorescence microscopy or biochemical fractionation

  • Assessing cellular fitness under proteotoxic stress conditions

Membrane Dynamics and Proteostasis:
As a transmembrane protein, TMEM170 might influence membrane properties or compartmentalization that could impact protein folding environments. Research approaches could include:

  • Membrane fluidity assessments in wild-type vs. TMEM170-deficient cells

  • Characterization of organelle integrity and function

  • Tracking the fate of aggregation-prone proteins in different cellular compartments

The unique ability of Dictyostelium to maintain proteostasis even when expressing proteins with long polyglutamine tracts makes it an excellent model for studying cellular mechanisms that suppress protein aggregation . Understanding TMEM170's potential role in this process could provide insights applicable to neurodegenerative diseases characterized by protein aggregation.

How can researchers integrate TMEM170 studies with Dictyostelium's bacteriolytic activity research?

Dictyostelium discoideum exhibits remarkable bacteriolytic activity, particularly at acidic pH resembling conditions found in phagosomes . Integrating TMEM170 studies with this research area could reveal novel insights:

Phagocytic Function Assessment:
Investigate whether TMEM170 plays a role in phagocytosis or phagosomal maturation by:

  • Generating TMEM170-knockout or overexpression strains

  • Measuring bacterial uptake and killing efficiency

  • Tracking phagosomal pH regulation and maturation

  • Comparing bacteriolytic activity in cell extracts from wild-type vs. modified strains

Subcellular Localization:
Determine TMEM170's localization during phagocytosis using fluorescently-tagged protein variants. Key questions to address:

  • Does TMEM170 localize to phagosomes during bacterial engulfment?

  • Does this localization change during phagosome maturation?

  • Does TMEM170 co-localize with known bacteriolytic proteins like BadA, BadB, or BadC ?

Interaction with Bacterial Killing Machinery:
Investigate whether TMEM170 interacts with components of the bacteriolytic machinery by:

  • Performing co-immunoprecipitation with known bacteriolytic proteins

  • Conducting genetic interaction studies with genes like kil1, which are known to be essential for efficient bacterial killing

  • Testing whether TMEM170 expression levels affect the expression or activity of bacteriolytic proteins

This integrated approach could reveal whether TMEM170 contributes to Dictyostelium's remarkable ability to kill bacteria, potentially identifying new therapeutic targets for enhancing bacterial clearance in infectious diseases.

What high-throughput screening approaches can be used to identify TMEM170 interacting partners?

Several high-throughput screening methodologies can be adapted for identifying TMEM170 interaction partners in Dictyostelium:

REMI-Based Genetic Screens:
Restriction enzyme-mediated integration (REMI) has been successfully used for genetic screens in Dictyostelium . This approach can be modified to identify genetic interactions with TMEM170:

  • Generate a REMI mutant library in a TMEM170-knockout or overexpression background

  • Screen for phenotypes of interest (growth, development, stress response)

  • Identify the disrupted genes in mutants showing synthetic phenotypes

  • Confirm genetic interactions through targeted approaches

Chemical-Genetic Profiling:
Use the NTG mutagenesis approach coupled with 5-fluoroorotic acid counterselection to identify genes that genetically interact with TMEM170:

  • Mutagenize TMEM170-modified strains

  • Select for suppressors or enhancers of TMEM170-associated phenotypes

  • Identify mutations through whole-genome sequencing

  • Validate identified interactions through targeted gene manipulation

Membrane Protein-Protein Interaction Screens:
For direct physical interaction partners, modified membrane-based two-hybrid systems or proximity labeling approaches can be employed:

  • Split-ubiquitin membrane yeast two-hybrid using Dictyostelium cDNA libraries

  • BioID or APEX2 proximity labeling with TMEM170 as the bait

  • Co-immunoprecipitation followed by mass spectrometry

  • Validation of identified interactions through co-localization and functional studies

These high-throughput approaches can provide comprehensive insights into TMEM170's functional network, potentially revealing its biological role in Dictyostelium.

How can researchers design experiments to elucidate TMEM170's role during Dictyostelium's complex life cycle?

Dictyostelium's unique life cycle provides multiple stages for investigating TMEM170 function:

Developmental Expression Analysis:

  • Quantify TMEM170 expression levels throughout development using RT-qPCR or RNA-seq

  • Generate a TMEM170-GFP fusion to track protein localization during different developmental stages

  • Compare expression patterns with known developmental regulators

Stage-Specific Requirement Testing:
Create an inducible TMEM170 knockout or overexpression system to manipulate protein levels at specific developmental stages:

  • Use promoters that are active at different developmental timepoints

  • Employ chemical-inducible systems for temporal control

  • Assess phenotypic consequences of stage-specific manipulation

Cell-Type Specific Analysis:
Determine whether TMEM170 functions differently in prestalk versus prespore cells:

  • Use cell-type specific promoters to drive TMEM170 expression

  • Conduct cell-sorting experiments to separate cell types and analyze TMEM170 levels

  • Assess cell fate determination in TMEM170-modified strains

Developmental Phenotype Characterization:
Thoroughly characterize development in TMEM170-modified strains:

  • Time-lapse imaging of the entire developmental process

  • Quantification of aggregation efficiency, mound formation, and fruiting body morphology

  • Assessment of spore viability and germination efficiency

  • Analysis of cell-cell adhesion and chemotactic responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.