Recombinant Dictyostelium discoideum Transmembrane protein 234 homolog (DDB_G0277575)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via recombinant DNA technology:

  • Expression System: E. coli .

  • Vector Design: The gene is cloned into an expression plasmid lacking introns, optimized for bacterial codon usage .

  • Purification: Affinity chromatography using the His-tag, followed by lyophilization for stability .

Functional and Genomic Context

The DDB_G0277575 gene is part of the Dictyostelium genome, which encodes ~12,500 proteins with diverse roles in secondary metabolism and environmental adaptation . While the exact biological role of Transmembrane Protein 234 Homolog remains uncharacterized, its structural features suggest involvement in:

  • Membrane Transport: Hydrophobic domains align with ABC transporter-like motifs .

  • Cellular Signaling: Potential interaction with cytosolic kinases or phosphatases, given Dictyostelium’s conserved signaling pathways .

Research Applications

This recombinant protein is primarily used in:

  • ELISA and Western Blotting: As a standard or positive control for antibody validation .

  • Structural Studies: Template for de novo protein design using AI-driven tools like RFdiffusion, which scaffold transmembrane domains into functional architectures .

  • Interaction Mapping: Investigation of protein-protein or protein-lipid interactions via microarrays .

Limitations and Future Directions

Current knowledge gaps include:

  • Functional Validation: No direct studies on its role in Dictyostelium physiology.

  • Post-Translational Modifications: Bacterial expression lacks eukaryotic glycosylation or phosphorylation .

Product Specs

Form
Lyophilized powder
Please note that we will preferentially ship the format currently in stock. However, if you have a specific requirement for the format, kindly indicate it in the order notes, and we will accommodate your request.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs. If you require shipping with dry ice, please inform us in advance as additional charges will apply.
Notes
It is recommended to avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize the development of the specified tag based on your request.
Synonyms
DDB_G0277575; Transmembrane protein 234 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0277575
Target Protein Sequence
MDTYNIISLLLVGFIWGGTNPLIKRGSEGVSKVKKDNFLSQIIYEFVYLWTRPSYTIPML INLSGSVVFFYTLSKVDISLVVPISNSLTFLFTSLMGMLLGEKVLHFKSYLGMIFVLAGV TICVSSKF
Uniprot No.

Target Background

Database Links
Protein Families
TMEM234 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it significant as a model organism?

Dictyostelium discoideum is a free soil-living amoeba that has become an essential model system for studying chemotaxis and cellular signaling mechanisms. This organism offers unique advantages for studying directed cell movement along extracellular gradients (chemotaxis), a process critical across diverse organisms from bacteria tracking food sources to immune cell responses in mammals . D. discoideum undergoes a remarkable developmental process from single-cell to multicellular states, making it valuable for investigating developmental biology, cell fate decisions, and social evolution . The organism's relatively simple genome, ease of genetic manipulation, and ability to form multicellular structures through aggregation provide researchers with a tractable system for exploring fundamental biological processes that are conserved in more complex organisms .

How should researchers properly store and handle recombinant DDB_G0277575 protein?

Proper storage and handling of recombinant DDB_G0277575 protein is essential for maintaining its structural integrity and biological activity. The recommended storage protocol is:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
Physical formLyophilized powder

For reconstitution, centrifuge the vial briefly before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (50% is standard) is recommended for long-term storage. After reconstitution, create small working aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality and activity . When handling the protein, maintain aseptic techniques and minimize exposure to room temperature to prevent degradation.

How should researchers design experiments to study DDB_G0277575's function in chemotaxis?

When designing experiments to investigate DDB_G0277575's role in chemotaxis, researchers should implement a systematic approach based on established experimental design principles:

First, clearly define your variables: use DDB_G0277575 expression or activity levels as your independent variable and chemotactic response measurements (e.g., directional movement, speed, persistence) as your dependent variable . Consider potential confounding factors such as cell density, developmental stage, and environmental conditions as extraneous variables that must be controlled.

Second, develop specific testable hypotheses about how DDB_G0277575 might affect chemotaxis. For example, hypothesize that cells with altered DDB_G0277575 expression will show quantifiable differences in response to chemoattractant gradients compared to control cells .

Design experimental treatments that include:

  • Wild-type cells (positive control)

  • DDB_G0277575 knockout or knockdown cells

  • DDB_G0277575 overexpression cells

  • Rescue experiments with recombinant protein

For gradient establishment, use microfluidic chambers or under-agarose assays to create stable chemoattractant gradients (typically cAMP or folic acid for Dictyostelium) . Implement time-lapse microscopy to track individual cell movements, and analyze data using specialized tracking software to quantify directionality, persistence, and speed .

Include appropriate controls such as buffer-only conditions and non-chemotactic mutants to validate your experimental system. This approach will enable robust assessment of DDB_G0277575's specific contributions to the complex process of chemotaxis .

What methodologies are appropriate for studying protein-protein interactions involving DDB_G0277575?

To investigate protein-protein interactions involving DDB_G0277575, researchers should employ multiple complementary approaches to ensure robust findings:

In vitro approaches:

  • Pull-down assays using His-tagged recombinant DDB_G0277575 as bait, coupled with mass spectrometry for unbiased identification of binding partners . The N-terminal His-tag on the recombinant protein facilitates purification using nickel affinity chromatography.

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) to determine binding kinetics and affinity constants between DDB_G0277575 and candidate interacting proteins.

  • Isothermal Titration Calorimetry (ITC) to characterize thermodynamic parameters of binding interactions.

In vivo approaches:

  • Co-immunoprecipitation (Co-IP) using antibodies against DDB_G0277575 or epitope-tagged versions expressed in Dictyostelium cells.

  • Proximity-based labeling techniques such as BioID or APEX, where DDB_G0277575 is fused to a biotin ligase or peroxidase that biotinylates proteins in close proximity.

  • Fluorescence Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in living cells.

When analyzing results, researchers should pay particular attention to potential G-protein interactions, as other Dictyostelium proteins like Ric8 have been shown to function as nonreceptor guanine nucleotide exchange factors for G-proteins, playing critical roles in signal transduction during chemotaxis and development . Cross-validation using multiple techniques is essential to distinguish genuine interactions from experimental artifacts.

How can RNA-sequencing be used to investigate DDB_G0277575's role in cellular processes?

RNA-sequencing provides a powerful approach to investigate DDB_G0277575's functional role within the broader cellular context:

First, design comparative transcriptomic experiments by creating DDB_G0277575 knockout or knockdown strains alongside control strains. For more nuanced analyses, consider conditional expression systems that allow temporal control over DDB_G0277575 expression .

Sample collection should occur at multiple developmental time points, particularly during transitions between single-cell and multicellular stages, to capture dynamic gene expression changes. Extract high-quality RNA using methods optimized for Dictyostelium, ensuring minimal contamination and degradation .

After sequencing, perform differential expression analysis to identify genes whose expression significantly changes in response to DDB_G0277575 manipulation. Look specifically for enrichment in biological processes related to membrane organization, signal transduction, cytoskeleton arrangement, and cAMP response, as these pathways are often altered during Dictyostelium development and social interactions .

Perform Gene Ontology (GO) enrichment analysis on differentially expressed genes to identify biological processes, molecular functions, and cellular components affected by DDB_G0277575 activity. Pay particular attention to genes involved in cyclic AMP response, cytoskeleton organization, and cell cycle regulation, as these were found to be differentially regulated during social interactions in Dictyostelium .

Validate key findings using quantitative PCR, protein expression analysis, or phenotypic assays to establish functional connections between transcriptomic changes and biological outcomes. This integrated approach can reveal DDB_G0277575's position within cellular signaling networks and its impact on developmental processes .

How does DDB_G0277575 potentially contribute to signaling pathways during Dictyostelium development?

DDB_G0277575's role in Dictyostelium development likely intersects with critical signaling pathways that govern the transition from single-cell to multicellular states. As a transmembrane protein, DDB_G0277575 may function as a sensor or transducer of environmental cues that trigger developmental progression.

In Dictyostelium, the cAMP signaling cascade is pivotal for chemotaxis and development, beginning with chemoattractant binding to specific receptors and subsequent activation of heterotrimeric G proteins . DDB_G0277575 may modulate this process directly or indirectly. Transcriptomic studies in Dictyostelium have shown that genes involved in cAMP response and cytoskeleton organization are often upregulated during multicellular development and in response to social conflict . If DDB_G0277575 functions within these pathways, it could influence critical developmental processes including aggregation, morphogenesis, and cell fate determination.

The protein's transmembrane structure suggests it could potentially act as a cell surface receptor or co-receptor that detects external signals or mediates cell-cell adhesion. Alternatively, it might function downstream of initial signal detection, perhaps as a scaffold for signaling complexes or as a regulator of membrane trafficking required for signal transduction .

Understanding DDB_G0277575's precise role would require systematic studies combining genetic manipulation with functional assays of key developmental signaling events, such as cAMP pulse generation and reception, calcium flux, and activation of developmental transcription factors.

What approaches can be used to analyze the evolutionary conservation and divergence of DDB_G0277575 across species?

To analyze evolutionary patterns of DDB_G0277575, researchers should implement a comprehensive comparative genomics approach:

Begin with sequence-based analyses by collecting homologous sequences across diverse taxonomic groups using BLAST searches against comprehensive databases. Generate multiple sequence alignments to identify conserved domains, motifs, and residues that may be functionally significant. Calculate selection metrics (dN/dS ratios) to identify regions under purifying, neutral, or positive selection.

Structural comparisons are equally important. Predict the three-dimensional structure of DDB_G0277575 and its homologs using computational methods, and compare structural features across species. Identify conserved structural elements that may indicate functional importance despite sequence divergence.

Functional analyses should complement sequence and structural studies. Compare expression patterns of DDB_G0277575 homologs across species using publicly available transcriptomic data. Conduct complementation experiments where homologs from different species are expressed in Dictyostelium DDB_G0277575 knockout strains to assess functional conservation.

Phylogenetic analysis will provide evolutionary context. Construct robust phylogenetic trees using appropriate models of sequence evolution to trace the evolutionary history of this gene family. Map major functional innovations or losses onto the phylogenetic tree to correlate molecular evolution with functional divergence.

This integrated approach will reveal whether DDB_G0277575 represents a conserved ancestral protein or a more recent evolutionary innovation, providing insights into its fundamental biological importance and species-specific adaptations .

How can researchers effectively study the role of DDB_G0277575 in cell-cell communication during social behavior?

Investigating DDB_G0277575's role in social behavior requires specialized approaches that capture the complexity of multicellular interactions:

Design chimeric aggregation experiments by mixing cells with fluorescently tagged DDB_G0277575 variants (wild-type, overexpression, or mutated) with differently labeled control cells. Monitor their sorting behavior, relative positions within multicellular structures, and ultimate cell fate decisions using confocal microscopy and cell tracking .

Perform transcriptomic analysis comparing gene expression in clonal versus chimeric aggregates to identify differentially expressed genes and pathways when cells encounter genetic non-relatives. Previous studies have shown that chimeric aggregates exhibit altered expression of genes involved in cytoskeleton organization, cAMP signaling, DNA replication, and cell cycle regulation .

Analyze developmental phenotypes by conducting time-series imaging of aggregation, mound formation, and fruiting body development in DDB_G0277575 mutants compared to wild-type. Quantify metrics such as time to aggregation, stream formation patterns, aggregate size, and timing of developmental transitions .

Implement microfluidic devices to create defined spatial gradients of signaling molecules and observe how DDB_G0277575-manipulated cells respond compared to controls. This approach can reveal subtle defects in signal sensing, amplification, or adaptation that affect collective behavior .

For mechanistic insights, analyze protein localization during key social transitions using fluorescently tagged DDB_G0277575. Determine whether the protein redistributes to specific cellular domains during cell-cell contact, aggregate formation, or stream establishment .

These approaches will elucidate whether DDB_G0277575 contributes to the complex social behaviors that characterize Dictyostelium's developmental cycle, potentially identifying new molecular mechanisms of cooperation and conflict resolution in microbial social groups.

What are common challenges when working with recombinant DDB_G0277575 protein and how can they be addressed?

When working with recombinant DDB_G0277575, researchers frequently encounter several challenges that can be systematically addressed:

Protein solubility issues:
As a transmembrane protein, DDB_G0277575 contains hydrophobic regions that can cause aggregation and precipitation. To improve solubility, optimize buffer conditions by testing different pH values (7.0-8.5), salt concentrations (150-500 mM NaCl), and detergents (0.1-1% non-ionic detergents like DDM, Triton X-100, or CHAPS). Adding glycerol (5-10%) or specific stabilizing agents like arginine can also enhance solubility .

Activity loss during storage:
To maintain protein activity during storage, strictly follow the recommended storage protocol: store at -20°C/-80°C in small aliquots with 50% glycerol to prevent freeze-thaw damage . For working solutions, limit storage at 4°C to one week maximum. Monitor protein stability using activity assays or biophysical methods like circular dichroism or fluorescence spectroscopy.

Protein-specific antibody limitations:
If commercial antibodies against DDB_G0277575 are unavailable or show poor specificity, leverage the His-tag on the recombinant protein for detection using anti-His antibodies . Alternatively, generate custom antibodies using purified recombinant protein or synthesized peptides from unique regions of DDB_G0277575.

Reconstitution challenges:
For optimal reconstitution, centrifuge the lyophilized protein briefly before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and ensure complete solubilization before use . If precipitation occurs upon reconstitution, try more gradual addition of water, gentle mixing without vortexing, or slightly warmer reconstitution temperatures (room temperature instead of 4°C).

Functional assay development:
Since the specific function of DDB_G0277575 may not be fully characterized, developing appropriate activity assays can be challenging. Begin with binding assays to identify interaction partners, followed by more specific functional tests based on these interactions or predicted functions from sequence homology and structural features .

How can researchers optimize experimental conditions for studying DDB_G0277575's function in cellular contexts?

Optimizing experimental conditions for DDB_G0277575 functional studies requires systematic approach across several parameters:

Expression system optimization:
When expressing DDB_G0277575 in heterologous systems, consider testing multiple expression vectors with different promoters (constitutive vs. inducible) and fusion tags (beyond His-tag) . For Dictyostelium-based studies, use vectors optimized for this organism with appropriate selection markers and promoters that provide controlled expression levels.

Cell culture conditions:
For Dictyostelium experiments, standardize culture conditions including growth media composition, cell density, and developmental induction protocols. Monitor developmental stage closely, as DDB_G0277575 function may vary throughout the life cycle . For developmental studies, synchronize cells by pulsing with cAMP or by nutrient deprivation protocols that yield consistent timing of developmental events.

Imaging protocol optimization:
For localization studies, optimize fixation methods (4% paraformaldehyde often works well for membrane proteins) and permeabilization conditions (test different detergents and concentrations). When using fluorescent protein fusions, ensure the tag doesn't interfere with localization by comparing N- and C-terminal fusions .

Knockout/knockdown strategy selection:
Consider multiple genetic manipulation approaches including CRISPR/Cas9-mediated knockout, RNA interference for knockdown, or dominant-negative mutant expression. Validate the effectiveness of each approach using quantitative PCR, western blotting, or functional assays .

Functional assays:
Based on the transmembrane nature of DDB_G0277575 and Dictyostelium biology, optimize assays for:

  • Chemotaxis (gradient steepness, chemoattractant concentration, observation timing)

  • Cell-cell adhesion (cell density, buffer composition, shear force application)

  • Developmental progression (substrate type, buffer composition, humidity control)

  • Signal transduction (stimulation time, concentration of agonists)

Document all optimization steps systematically, as the optimal conditions themselves may provide insights into DDB_G0277575's biological function and biochemical properties.

What are promising areas for future research on DDB_G0277575 and its role in cellular processes?

Several promising research directions could significantly advance our understanding of DDB_G0277575:

Integration with G-protein signaling networks:
Investigate potential interactions between DDB_G0277575 and heterotrimeric G-protein components, similar to studies on Ric8 in Dictyostelium . Determine whether DDB_G0277575 influences guanine nucleotide exchange activity or G-protein localization during signal transduction events, particularly in response to chemoattractants.

Role in membrane organization and dynamics:
Explore how DDB_G0277575 contributes to plasma membrane organization, potentially forming or stabilizing signaling microdomains. Investigate its dynamics during membrane reorganization events that occur during chemotaxis, phagocytosis, or multicellular development using advanced imaging techniques like super-resolution microscopy or single-particle tracking.

Contribution to mechanosensing:
As a transmembrane protein, DDB_G0277575 might participate in sensing mechanical forces during cell movement or multicellular morphogenesis. Design experiments using substrate stiffness gradients or applied mechanical stress to test whether DDB_G0277575 functions in mechanotransduction pathways that influence Dictyostelium behavior.

Involvement in intercellular recognition:
Investigate whether DDB_G0277575 contributes to kin discrimination mechanisms in Dictyostelium, similar to the role of TgrB1/TgrC1 adhesion proteins . Determine if its expression or localization changes during chimeric development compared to clonal development, potentially mediating responses to genetic relatedness.

Systems biology approaches:
Integrate DDB_G0277575 into comprehensive models of Dictyostelium signaling networks using proteomics, transcriptomics, and computational modeling. Map its position within the signaling cascade relative to established components of chemotaxis and developmental pathways .

These research directions would collectively advance our understanding of membrane protein function in social amoebae while potentially revealing conserved mechanisms relevant to human health and disease.

How might studies of DDB_G0277575 contribute to broader understanding of evolutionary biology and cellular communication?

Research on DDB_G0277575 has the potential to illuminate fundamental principles across multiple biological disciplines:

Evolution of multicellularity:
Dictyostelium occupies a fascinating evolutionary position as a facultatively multicellular organism, transitioning between unicellular and multicellular states in response to environmental cues . Studying transmembrane proteins like DDB_G0277575 can reveal molecular mechanisms that facilitated the evolution of multicellularity, particularly how single cells coordinate their behaviors to function as cohesive units. Understanding how membrane proteins mediate intercellular communication in this context may identify conserved principles that enabled the independent evolution of multicellularity across diverse lineages.

Conflict resolution in social systems:
Dictyostelium aggregates face potential evolutionary conflicts when genetically different strains form chimeras . If DDB_G0277575 contributes to processes like kin recognition, cooperative signaling, or cell fate determination, its study could reveal molecular mechanisms that mediate conflict and cooperation in biological collectives. This would connect molecular mechanisms to social evolution theory, advancing our understanding of how molecular interactions scale to population-level phenomena.

Conserved signaling principles:
G-protein signaling pathways are remarkably conserved across eukaryotes, from amoebae to humans . Investigating how DDB_G0277575 interfaces with these pathways could reveal conserved principles of signal detection, amplification, and adaptation. These insights could inform our understanding of analogous processes in human cells, particularly in contexts like immune cell migration, neural development, or cancer metastasis where directed cell movement plays crucial roles.

Self-organization in biological systems:
Dictyostelium aggregation exemplifies biological self-organization, where local interactions between cells generate complex collective behaviors without centralized control . If DDB_G0277575 influences these interactions, its study could reveal generalizable principles about how molecular components enable robust self-organization across scales of biological complexity, from protein complexes to tissues.

These broader contributions highlight how detailed mechanistic studies of specific proteins like DDB_G0277575 can address fundamental questions in biology that transcend individual model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.