Recombinant Dictyostelium discoideum Transmembrane protein 33 homolog (tmem33)

Shipped with Ice Packs
In Stock

Description

ER Morphogenesis

TMEM33 regulates ER tubule formation by binding to reticulons (RTNs), proteins that shape ER membranes. It suppresses RTN4C-induced ER tubulation, maintaining ER structural equilibrium .

Cellular Proliferation and Cancer

  • In human cervical cancer, high TMEM33 expression correlates with poor prognosis (HR = 1.5, p < 0.001) and promotes tumorigenesis by enhancing cell proliferation .

  • Knockdown of TMEM33 reduces DNA synthesis (EdU assay: 40% decrease in HeLa cells) and colony formation .

Immune and Pathogen Interactions

  • TMEM33 modulates immune pathways (e.g., innate immune system, complement cascade) .

  • Dictyostelium TMEM33 homologs are studied in host-pathogen models, such as Salmonella survival assays .

Mechanistic Studies

  • ER Dynamics: Used to study reticulon-mediated ER remodeling .

  • Cancer Biology: Investigated for its oncogenic role via PKM2-TMEM33 axis in lipid metabolism (e.g., SREBP activation) .

Pathogen-Host Models

  • Dictyostelium serves as a model for Salmonella infections; TMEM33 may influence phagocytosis evasion mechanisms .

Table 2: TMEM33-Regulated Pathways

PathwayFunction
Lipid MetabolismSREBP activation via RNF5-SCAP axis
Calcium SignalingVEGF-mediated angiogenesis in zebrafish
ER Stress ResponseModulates ERAD through RNF5

Future Research Directions

  1. ER Dynamics: Elucidate TMEM33’s role in ER-mitochondria contact sites.

  2. Therapeutic Targeting: Evaluate TMEM33 inhibitors in cancer models.

  3. Evolutionary Conservation: Compare Dictyostelium TMEM33 with human homologs in disease contexts .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term storage stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50%. This can serve as a reference for your own protocols.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid protein solutions have a shelf life of 6 months at -20°C/-80°C. Lyophilized protein powders have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
tmem33; DDB_G0286009; Transmembrane protein 33 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmem33
Target Protein Sequence
MSSPKFDSYDWENDPNWKEFTGTSTSINKLKEEYFKKNIDPNYKSSNNTTTQRPSTSSSS RTSSSSTSSPRATRAKPTFRRFLYGAWVIAQISVILFTLFYFISGNPYFFYKALLGATIA YSIPIFNTFEGRKPDRALAAQLVQDENAQFVFYCMIFYFFGSSSLVYLLPNFIYSFFHML KIVIPYTSSVPFIKNLLEKVNSTNAKAIDFAISVEINIVLIAFFGIFSSFSNILLVFIYF RYLKLRYQFSQKIKSKINEYSQMVDQLSAHPSCPTFIRNIIPKIKMVLSR
Uniprot No.

Target Background

Database Links
Protein Families
PER33/POM33 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is TMEM33 and what are its known functions in eukaryotic cells?

    TMEM33 (Transmembrane Protein 33) is primarily an endoplasmic reticulum (ER) protein that influences the tubular structure of the ER and modulates intracellular calcium homeostasis . In zebrafish, TMEM33 functions as a negative regulator of virus-triggered interferon induction through two mechanisms: mitochondrial antiviral signaling protein (MAVS) ubiquitination and reduction of TANK binding kinase 1 (TBK1) kinase activity . In fission yeast, the TMEM33 homolog Tts1 functions in remodeling the nuclear envelope during mitosis, specifically in promoting spindle pole body insertion and modulating nuclear pore complex distribution . While specific functions in Dictyostelium discoideum have not been fully characterized, these conserved roles likely extend to this organism with potential adaptations for its unique cellular processes.

  • What structural features characterize TMEM33 proteins?

    TMEM33 proteins typically contain multiple transmembrane domains that anchor them in the ER membrane. Functional domain analyses in zebrafish have revealed that the N-terminal transmembrane domains 1 (TM1) and 2 (TM2) are necessary for interferon suppression . In fission yeast Tts1 (TMEM33 homolog), an amphipathic helix located at the C-terminus is important for ER shaping and modulating mitotic nuclear pore complex distribution. Additionally, evolutionarily conserved residues at the luminal interface of the third transmembrane region are specifically involved in promoting spindle pole body-nuclear envelope insertion . These structural features likely drive the partitioning of TMEM33 to high-curvature ER domains, which is crucial for its function.

  • Why is Dictyostelium discoideum a useful model for studying transmembrane proteins?

    Dictyostelium discoideum amoebae are haploid organisms that share many features with animal cells, making them ideal for studying basic processes like cell locomotion . Their haploid nature simplifies genetic manipulation and phenotype analysis. Research has shown that transmembrane proteins in D. discoideum adopt three free diffusion states with similar diffusion coefficients regardless of their structural variability, allowing for comparative studies across different membrane proteins . The relationship between protein size and diffusion coefficient in this organism follows the Saffman–Delbrück model, indicating that membrane viscosity rather than protein size is the major determinant of lateral diffusion . Furthermore, established genetic modification techniques, including enhanced homologous recombination approaches using loxP sites, enable efficient genetic manipulation in this organism .

Advanced Research Questions

  • How can homologous recombination efficiency be enhanced for genetic manipulation of tmem33 in Dictyostelium?

    Homologous recombination efficiency at different genetic loci in Dictyostelium can vary significantly (from 0-30% typical efficiency). To enhance recombination at the tmem33 locus, researchers can implement a strategy using single loxP sites as demonstrated with the sec1A gene. This approach involves:

    1. Engineering a Dictyostelium cell line containing a single loxP site adjacent to the 3′ end of the tmem33 gene

    2. Creating a tmem33 replacement DNA that also contains a single loxP site in a homologous position

    3. Introducing this replacement DNA into the engineered cell line

    4. Expressing CRE recombinase to drive recombination between the two loxP sites

    This method has been shown to increase homologous recombination efficiency from ~25% to ~80% at the sec1A locus, presumably through intermolecular recombination between the single loxP sites . This enhanced efficiency would facilitate the generation of conditional mutants or tagged versions of tmem33 for functional studies.

  • What methodologies are most effective for studying TMEM33 localization and dynamics in Dictyostelium?

    To study TMEM33 localization and dynamics in Dictyostelium, researchers can employ a combination of complementary approaches:

    1. Subcellular Localization Analysis:

      • Create epitope-tagged TMEM33 constructs (e.g., Myc-TMEM33) for expression in Dictyostelium

      • Perform immunofluorescence staining with organelle markers (Calnexin or ER-tracker for ER, mito-tracker for mitochondria)

      • Conduct subcellular fractionation followed by immunoblotting to biochemically confirm localization

    2. Dynamic Behavior Analysis:

      • Use HaloTag fusion constructs for single-molecule imaging as successfully applied for other transmembrane proteins in D. discoideum

      • Apply a hidden Markov model to analyze single-molecule trajectories

      • Quantify diffusion coefficients in different membrane environments

      • Assess the impact of cytoskeletal inhibitors on TMEM33 mobility

    These combined approaches would provide comprehensive information about both the static localization and dynamic behavior of TMEM33 in Dictyostelium cells.

  • How might TMEM33 contribute to ER stress responses in Dictyostelium?

    Based on findings in other organisms, TMEM33 likely plays a significant role in ER stress responses in Dictyostelium. In mammalian cells, TMEM33 functions as a regulator of the unfolded protein response (UPR) signaling cascade through its interactions with PERK and IRE1α . To investigate this function in Dictyostelium, researchers should:

    1. Generate TMEM33 knockout or overexpression strains using enhanced homologous recombination techniques

    2. Challenge cells with ER stress inducers (e.g., tunicamycin, thapsigargin)

    3. Monitor changes in UPR markers:

      • Phosphorylation status of PERK and IRE1α homologs

      • Expression of downstream effectors similar to ATF4-CHOP and XBP1-S

      • Levels of apoptotic signals (caspase homologs) and autophagy markers (LC3II equivalent)

    4. Perform co-immunoprecipitation to identify TMEM33 interaction partners in the UPR pathway

    Exogenous expression of TMEM33 in other systems leads to increased expression of phosphorylated eIF2α and IRE1α along with their downstream effectors , suggesting similar roles might exist in Dictyostelium.

  • What role might TMEM33 play in nuclear envelope remodeling during mitosis in Dictyostelium?

    Based on the function of Tts1 (TMEM33 homolog) in fission yeast, TMEM33 in Dictyostelium might participate in nuclear envelope remodeling during mitosis. In fission yeast, Tts1 promotes insertion of spindle pole bodies in the nuclear envelope at the onset of mitosis and modulates distribution of nuclear pore complexes during mitotic nuclear envelope expansion . To investigate this potential role in Dictyostelium, researchers should:

    1. Create fluorescently tagged TMEM33 constructs to visualize its localization during the cell cycle

    2. Co-express markers for the nuclear envelope and spindle pole bodies

    3. Perform live-cell imaging through mitosis in wild-type and TMEM33-depleted cells

    4. Conduct structure-function analysis to identify domains required for nuclear envelope remodeling

    Particular attention should be paid to the amphipathic helix at the C-terminus and conserved residues in the transmembrane regions, which are crucial for these functions in fission yeast .

  • How can researchers generate conditional tmem33 mutants in Dictyostelium?

    If TMEM33 proves to be essential in Dictyostelium, conditional mutants will be valuable for functional studies. Temperature-sensitive (ts) mutants can be generated using an approach similar to that used for nsfA and sec1A genes:

    1. Create a library of mutagenized tmem33 genes containing a selectable marker through error-prone PCR

    2. Transform Dictyostelium cells using the enhanced homologous recombination approach with loxP sites

    3. Select transformants using the appropriate antibiotic

    4. Screen colonies for temperature sensitivity (normal growth at permissive temperature, growth defects at restrictive temperature)

    5. Confirm the genotype of potential ts mutants by sequencing

    6. Characterize the phenotypes of ts mutants at restrictive temperature

    This approach enabled the isolation of 30 ts mutants in sec1A, some of which showed specific defects such as cessation of movement at the restrictive temperature . Similar phenotypic screens for TMEM33 mutants could reveal its specific functions.

Experimental Methodologies and Protocols

  • What is the optimal protocol for cloning and expressing recombinant tmem33 in Dictyostelium?

    For effective cloning and expression of recombinant TMEM33 in Dictyostelium, follow this protocol:

    1. cDNA Amplification:

      • Extract total RNA from Dictyostelium cells

      • Synthesize cDNA using reverse transcriptase

      • Design primers incorporating:

        • Restriction sites (e.g., BglII and MulI)

        • Optional epitope tag (e.g., Myc tag)

      • PCR conditions:

        • Initial denaturation: 95°C for 4 min

        • 40 cycles: 94°C for 30s, 65°C for 1 min, 72°C for 1 min

        • Final extension: 72°C for 5 min

    2. Cloning:

      • Clone PCR product into a suitable Dictyostelium expression vector

      • Verify sequence by automated DNA sequencing of both strands

    3. Transfection:

      • Transfect Dictyostelium cells using electroporation

      • For reference, in other cell types, various transfection reagents have been used: Lipofectamine 2000 (COS-1, HEK-293T, PC-3), FuGene HD (HeLa), or Lipofectamine LTX (MCF-7, MDA-MB231)

    4. Expression Verification:

      • Confirm expression by immunoblotting with anti-TMEM33 or anti-tag antibodies

      • Verify correct subcellular localization by immunofluorescence

    This protocol is adapted from successful approaches used for other transmembrane proteins .

  • How can researchers analyze the effect of TMEM33 on lateral diffusion of membrane proteins?

    To analyze how TMEM33 affects lateral diffusion of membrane proteins in Dictyostelium, researchers should:

    1. Preparation of Experimental Cell Lines:

      • Generate TMEM33 knockout or overexpression lines

      • Express HaloTag-fused membrane proteins of interest for single-molecule tracking

    2. Single-Molecule Imaging:

      • Label HaloTag fusion proteins with appropriate fluorescent ligands

      • Perform single-molecule imaging using total internal reflection fluorescence (TIRF) microscopy

    3. Trajectory Analysis:

      • Apply hidden Markov model to single-molecule trajectories

      • Determine diffusion states and calculate diffusion coefficients

      • Compare results between wild-type and TMEM33-modified cells

    4. Cytoskeleton Perturbation:

      • Treat cells with inhibitors of microtubules, actin, or myosin II

      • Assess how TMEM33 affects the response of membrane proteins to cytoskeletal disruption

    Studies have shown that transmembrane proteins in Dictyostelium adopt three free diffusion states regardless of their structural variability, with diffusion coefficients following the Saffman–Delbrück model . TMEM33 may influence these properties, particularly if it affects membrane organization or interactions with the cytoskeleton.

  • What analytical methods are appropriate for studying TMEM33's role in antiviral responses?

    Based on TMEM33's role in zebrafish as a negative regulator of virus-triggered interferon induction , researchers can investigate potential immune-related functions in Dictyostelium using:

    1. Gene Expression Analysis:

      • Generate TMEM33 knockout, knockdown, or overexpression lines

      • Challenge cells with viral components or pathogen-associated molecular patterns

      • Measure expression of immune response genes using qRT-PCR or RNA-seq

    2. Protein Interaction Studies:

      • Investigate whether TMEM33 interacts with Dictyostelium homologs of:

        • Mitochondrial antiviral signaling protein (MAVS)

        • TANK binding kinase 1 (TBK1)

        • RIG-I-like receptors (RLRs)

      • Perform co-immunoprecipitation followed by Western blotting or mass spectrometry

    3. Functional Assays:

      • Assess ubiquitination status of potential MAVS homologs

      • Evaluate phosphorylation of TBK1-like kinases

      • Determine if TMEM33 serves as a decoy substrate for kinases

    4. Domain Function Analysis:

      • Create truncation or point mutation variants focusing on TM1 and TM2 domains

      • Assess which domains are necessary for immune response regulation

    While Dictyostelium lacks interferon genes, it possesses sophisticated innate immune mechanisms that TMEM33 might influence through conserved signaling pathways .

  • What approaches can measure TMEM33's impact on ER morphology?

    To quantitatively assess TMEM33's effect on ER morphology in Dictyostelium:

    1. ER Visualization:

      • Express fluorescent ER markers (e.g., GFP-HDEL) in wild-type and TMEM33-modified cells

      • Acquire high-resolution confocal or super-resolution images

    2. Quantitative Analysis:

      • Measure ER tubule length, network complexity, and tubule-sheet ratio

      • Quantify ER network junctions and polygon size

      • Analyze ER-PM contact sites

    3. Dynamic Analysis:

      • Perform live-cell imaging to assess ER remodeling rates

      • Measure FRAP (Fluorescence Recovery After Photobleaching) to evaluate ER continuity

    4. Ultrastructural Analysis:

      • Use transmission electron microscopy to examine ER ultrastructure

      • Apply electron tomography for 3D reconstruction of the ER network

    These approaches would help determine whether TMEM33 in Dictyostelium, like its homologs in other organisms, influences ER morphology through its membrane-shaping properties.

Comparative and Advanced Analysis

  • How do the diffusion properties of transmembrane proteins in Dictyostelium compare across different experimental conditions?

    Table 1: Diffusion Properties of Transmembrane Proteins in Dictyostelium discoideum

    Diffusion StateDiffusion Coefficient (μm²/s)Proportion (%)Effect of Cytoskeleton Disruption
    Fast0.1-0.220-30Reduced mobility
    Medium0.01-0.0540-50Reduced mobility
    Slow0.001-0.00520-30Reduced mobility

    All transmembrane proteins in Dictyostelium undergo free diffusion in three distinct states with similar diffusion coefficients regardless of their structural variability . All protein species show reduced mobility upon inhibition of microtubule or actin cytoskeleton dynamics, or myosin II. The relationship between protein size and diffusion coefficient conforms to the Saffman–Delbrück model, indicating that membrane viscosity, rather than protein size, is the primary determinant of lateral diffusion . These protein species-independent properties can be explained by free diffusion across three membrane regions with different viscosities.

  • How does TMEM33 function compare across different model organisms?

    Table 2: Comparative Functions of TMEM33 Across Model Organisms

    OrganismCellular LocalizationPrimary FunctionsKey DomainsInteraction Partners
    MammalsER membraneER stress response, UPR signaling, Ca²⁺ regulationMultiple TM domainsPERK, IRE1α
    ZebrafishER membraneNegative regulation of antiviral immunityN-terminal TM1 and TM2MAVS, TBK1, RLRs
    Fission Yeast (Tts1)ER, nuclear envelopeNuclear envelope remodeling, SPB insertion, NPC distributionC-terminal amphipathic helix, TM3 luminal interfaceSPBs, NPCs
    Dictyostelium (predicted)ER, possibly nuclear envelopeLikely ER structure maintenance, stress response, possibly cell motilityTM domains (predicted)To be determined

    While TMEM33 functions vary across organisms, core roles in ER structure and stress responses appear conserved. The Dictyostelium homolog likely shares these functions but may have unique adaptations related to this organism's specialized cellular processes, such as chemotaxis or development.

  • What strategies can overcome challenges when studying transmembrane proteins like TMEM33 in Dictyostelium?

    Studying transmembrane proteins in Dictyostelium presents several challenges. Here are strategies to address them:

    1. Low Homologous Recombination Efficiency:

      • Implement the loxP-enhanced recombination system demonstrated for sec1A

      • Consider CRISPR-Cas9 approaches for more efficient gene targeting

    2. Protein Expression Challenges:

      • Optimize codon usage for Dictyostelium

      • Use inducible expression systems to control expression levels

      • Consider Dictyostelium-specific promoters for appropriate expression timing

    3. Functional Redundancy:

      • Create multiple knockouts if paralogs exist

      • Perform complementation with orthologs from other species to test functional conservation

    4. Imaging Challenges:

      • Use specific tags (HaloTag, SNAP-tag) that allow for pulse-chase labeling

      • Apply super-resolution microscopy techniques (PALM, STORM) for detailed localization

      • Consider expansion microscopy for improved resolution in dense structures like the ER

    5. Biochemical Analysis:

      • Develop optimized membrane protein extraction protocols

      • Use crosslinking approaches to capture transient interactions

      • Apply proximity labeling (BioID, APEX) to identify interacting proteins in native conditions

    These strategies can help overcome the technical challenges associated with studying TMEM33 and other transmembrane proteins in Dictyostelium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.