Recombinant Dictyostelium discoideum Transmembrane protein 50 homolog (tmem50)

Shipped with Ice Packs
In Stock

Description

Neurological and Cellular Studies

Dictyostelium serves as a model for neurological disorders (e.g., Alzheimer’s, Parkinson’s) due to conserved cellular pathways . While tmem50 itself is not directly cited in these studies, its transmembrane nature may align with:

  • Membrane trafficking or signaling, given its structural similarity to TMEM50A, which is linked to RH blood group loci in humans .

  • Autophagy regulation, as γ-secretase complexes (studied in Dictyostelium) influence phagocytosis and macropinocytosis .

Pharmacological and Biomedical Research

Dictyostelium derivatives, including polyketides and secondary metabolites, are explored for drug discovery . tmem50’s recombinant availability enables:

  • High-throughput screening for membrane-targeted therapies.

  • Structural studies to elucidate conserved transmembrane protein mechanisms.

Product Variants and Handling Considerations

Commercial recombinant tmem50 is available in multiple formats:

ProductDetails
RFL5568DFHis-tagged, full-length (1-156 aa), >90% purity
ELISA-grade50 µg/vial, optimized for immunological assays

Handling Notes:

  • Avoid repeated freeze-thaw cycles .

  • Reconstitute in sterile water or buffer with glycerol for stability .

Comparative Analysis with Human TMEM50A

Key differences and similarities:

Featuretmem50 (Dictyostelium)TMEM50A (Human)
Genomic LocationDDB_G0281983 Chromosome 1p36.11 (RH locus)
Tissue ExpressionBroad (model organism context) Ubiquitous, higher in parathyroid/brain
Functional InsightsLimited; inferred from homology Linked to RH haplotypes; unknown function

Future Directions

Further research is needed to:

  1. Elucidate functional roles through knockdown or overexpression studies in Dictyostelium.

  2. Explore therapeutic targets leveraging its transmembrane structure.

  3. Validate cross-species utility in human disease models.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem50; DDB_G0281983; Transmembrane protein 50 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmem50
Target Protein Sequence
MRKTIMKYLPALAGIIFTAGWFLWIDGHVYENTNNKNADFDGPHIQWIYYLPGIFATLGM VMANIVDLSALNSNSLLFDGGATKVRVWLFISFAISFGCIGAALWIMVAVFLPPHNTNDA AQWPGIAITLQTSLIFLSSLLLVFKKVRQDDEYDQF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0220 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum tmem50 and why is it significant for research?

Transmembrane protein 50 homolog (tmem50) from Dictyostelium discoideum is a 156-amino acid membrane protein (UniProt ID: Q54T60) that belongs to the transmembrane protein 50B family. The significance of this protein lies in Dictyostelium's role as a model organism for studying eukaryotic cell motility, chemotaxis, and developmental processes. Dictyostelium discoideum serves as both a non-mammalian model of human disease and a eukaryotic model for cell motility, making its proteins valuable for comparative studies across species .

The protein is encoded by the gene tmem50 (also known as DDB_G0281983) and contains multiple transmembrane domains characteristic of membrane transport proteins. Research interest in tmem50 has increased due to its potential involvement in cellular signaling pathways and membrane organization, though its precise function remains under investigation.

How is recombinant tmem50 typically expressed and purified?

Recombinant tmem50 is typically expressed using E. coli expression systems with an N-terminal His-tag to facilitate purification. The expression construct includes the full-length protein (amino acids 1-156) . The general methodology includes:

  • Cloning the tmem50 gene into an appropriate expression vector with a His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Cell lysis and membrane preparation

  • Solubilization of the membrane fraction using detergents

  • Affinity purification using Ni-NTA or similar matrices that bind the His-tag

  • Further purification steps as needed (size exclusion chromatography, ion exchange)

  • Quality control by SDS-PAGE and Western blotting

The purified protein is typically stored as a lyophilized powder or in a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability .

What are the optimal storage conditions for recombinant tmem50?

To maintain the stability and activity of recombinant tmem50, the following storage conditions are recommended:

Storage FormTemperatureBuffer CompositionAdditional Notes
Lyophilized-20°C to -80°CN/AMost stable form for long-term storage
Reconstituted-20°C to -80°CTris/PBS-based buffer, pH 8.0, with 50% glycerolAliquot to avoid freeze-thaw cycles
Working solution4°CTris/PBS-based bufferStable for up to one week

Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein stability and activity. For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What expression systems are most effective for functional studies of tmem50?

For functional studies of tmem50, researchers should consider both prokaryotic and eukaryotic expression systems, each with distinct advantages:

E. coli Expression System:

  • Advantages: High yield, cost-effective, easy to scale up

  • Limitations: Lack of post-translational modifications, potential for improper folding of membrane proteins

  • Optimization strategies: Use specialized E. coli strains (such as C41/C43), lower expression temperature (16-25°C), and specific detergents for solubilization

  • Best for: Structural studies, antibody production, interaction studies requiring large amounts of protein

Dictyostelium Expression System:

  • Advantages: Native environment, proper folding and post-translational modifications, ability to study function in vivo

  • Methodology: The Disc I gamma promoter system in Dictyostelium allows regulated expression of heterologous proteins. A mutant strain that overexpresses discoidins can increase expression 10-100 fold when genes are placed under control of the Disc I gamma promoter

  • Best for: Functional studies in the native cellular context, protein localization studies, identifying interaction partners

For optimal results in functional studies, expressing tmem50 in its native Dictyostelium environment often provides the most physiologically relevant data, particularly when studying membrane localization, trafficking, or protein-protein interactions .

How can researchers optimize purification protocols for membrane-bound tmem50?

Purifying membrane proteins like tmem50 presents specific challenges due to their hydrophobic nature. An optimized purification protocol should include:

  • Membrane Preparation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g)

    • Collect membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Detergent Selection:

    • Test multiple detergents for solubilization efficiency (DDM, LDAO, Triton X-100)

    • Begin with milder detergents to maintain protein structure and function

    • Optimize detergent concentration using a detergent screen

  • Affinity Purification:

    • Incubate solubilized membrane fraction with Ni-NTA resin

    • Use gradient washing with increasing imidazole to reduce non-specific binding

    • Elute with high imidazole concentration (250-500 mM)

  • Further Purification:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Monitor protein quality with dynamic light scattering and thermal stability assays

  • Quality Control:

    • Assess purity by SDS-PAGE (should exceed 90%)

    • Verify identity by mass spectrometry or Western blotting

    • Evaluate functionality through appropriate activity assays

For structural studies, consider additional strategies such as incorporating stabilizing mutations or using antibody fragments to improve crystallization properties.

What techniques are most effective for studying tmem50 membrane topology?

Understanding the membrane topology of tmem50 requires specialized techniques that can determine the orientation and membrane-spanning regions of the protein:

  • Computational Prediction Methods:

    • Hydropathy plot analysis to identify potential transmembrane domains

    • Topology prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Comparative modeling based on homologous proteins with known structures

  • Experimental Approaches:

    • Cysteine Scanning Mutagenesis: Introduce cysteine residues at different positions and test their accessibility to membrane-impermeable sulfhydryl reagents

    • Protease Protection Assays: Limited proteolysis of intact membranes vs. permeabilized membranes to identify protected domains

    • Glycosylation Mapping: Insert glycosylation sites at various positions to determine lumenal exposure

    • FRET Analysis: Measure distances between domains using fluorescently labeled residues

    • Cryo-Electron Microscopy: For high-resolution structural determination in a near-native lipid environment

  • Biochemical Validation:

    • Cross-linking studies to identify proximity relationships between domains

    • Accessibility studies using membrane-permeable and impermeable reagents

    • Site-directed antibodies against specific domains

These approaches, used in combination, can provide a comprehensive understanding of how tmem50 is oriented within the membrane and how this orientation relates to its function.

What are the challenges in conducting functional studies with tmem50?

Functional characterization of transmembrane proteins like tmem50 presents several specific challenges:

  • Expression and Purification Barriers:

    • Low expression levels common with membrane proteins

    • Maintaining proper folding during extraction from membranes

    • Selecting appropriate detergents that preserve function

    • Obtaining sufficient quantities of pure, homogeneous protein

  • Functional Assay Development:

    • Lack of known enzymatic activity or binding partners

    • Need for reconstitution into artificial membrane systems

    • Developing appropriate activity assays without known function

  • Structural Characterization Difficulties:

    • Challenges in obtaining crystals for X-ray crystallography

    • Conformational heterogeneity in solution

    • Requirement for specific lipid environments

  • Methodological Approaches to Address Challenges:

    • Use of nanodiscs or liposomes for functional reconstitution

    • Incorporation of thermostabilizing mutations

    • Application of advanced microscopy techniques like single-particle cryo-EM

    • Genetic approaches like CRISPR-Cas9 to study function in vivo

    • Protein-protein interaction studies using techniques adapted for membrane proteins (split-ubiquitin yeast two-hybrid, proximity labeling)

For tmem50 specifically, leveraging the genetic tractability of Dictyostelium can provide advantages for functional studies. Creating knockout or knockdown strains can help identify phenotypes, while fluorescent protein fusions can reveal subcellular localization and dynamics.

How can tmem50 be used in studies of cell migration and chemotaxis?

Dictyostelium discoideum is an established model organism for studying directed cell migration and chemotaxis, particularly in response to cAMP . Tmem50, as a membrane protein, could potentially be involved in sensing or transducing chemotactic signals. Research applications include:

  • Role in Chemotactic Signaling:

    • Generate tmem50 knockout or knockdown strains to assess effects on chemotaxis

    • Use fluorescently tagged tmem50 to visualize protein dynamics during chemotaxis

    • Investigate potential interactions with known chemotaxis pathway components

  • Methodological Approaches:

    • Under-agarose Chemotaxis Assays: Measure directed migration toward cAMP

    • Micropipette Chemotaxis Assays: Observe cellular responses to localized cAMP gradients

    • FRET-based Biosensors: Monitor signaling pathway activation in relation to tmem50 localization

    • Quantitative Image Analysis: Track cell movement parameters (speed, directionality, persistence)

  • Developmental Context:

    • Study how tmem50 function relates to the developmental transition triggered by starvation

    • Investigate potential roles in cell-cell adhesion during multicellular development

  • Translation to Human Health:

    • Identify human homologs of tmem50 and their potential roles in immune cell chemotaxis

    • Apply findings to understand aberrant cell migration in disease contexts

The robust chemotactic responses of Dictyostelium to cAMP make this system powerful for elucidating the function of membrane proteins like tmem50 in directed cell migration .

How does tmem50 from Dictyostelium compare to its homologs in other species?

Comparative analysis of tmem50 across species provides insights into evolutionary conservation and potential functional significance:

SpeciesProtein NameSimilarity to Dictyostelium tmem50Known/Predicted Function
Dictyostelium discoideumTransmembrane protein 50 homologReference sequenceUnknown, potentially involved in membrane organization
Homo sapiensTMEM50A/BModerate sequence similarityAssociated with red blood cell surface antigens (TMEM50A); brain development (TMEM50B)
Mus musculusTMEM50A/BModerate sequence similaritySimilar to human homologs
Saccharomyces cerevisiaeRelated membrane proteinsLow sequence similarityVarious membrane transport functions

Research methodologies for comparative studies include:

  • Sequence Analysis:

    • Multiple sequence alignment to identify conserved residues

    • Phylogenetic analysis to understand evolutionary relationships

    • Conservation mapping onto predicted structural models

  • Functional Complementation:

    • Express human TMEM50 proteins in Dictyostelium tmem50 knockout strains

    • Assess rescue of phenotypes to determine functional conservation

  • Domain Swapping:

    • Create chimeric proteins with domains from different species

    • Identify which regions are responsible for species-specific functions

  • Expression Pattern Comparison:

    • Compare tissue/cell type expression patterns across species

    • Identify conserved regulatory elements in promoter regions

Understanding the evolutionary relationships between tmem50 homologs can provide valuable insights into fundamental functions conserved across eukaryotes versus species-specific adaptations .

What techniques are available for studying protein-protein interactions involving tmem50?

Identifying interaction partners of membrane proteins requires specialized techniques that account for their hydrophobic nature and membrane environment:

  • In vitro Approaches:

    • Pull-down Assays: Use purified His-tagged tmem50 as bait to identify binding partners

    • Co-immunoprecipitation: Precipitate tmem50 from cell lysates and identify co-precipitating proteins

    • Surface Plasmon Resonance: Measure binding kinetics with potential interacting proteins

    • Cross-linking Mass Spectrometry: Identify proximity relationships in native membrane environments

  • Cell-based Methods:

    • Split-Ubiquitin Yeast Two-Hybrid: Modified Y2H system designed for membrane proteins

    • FRET/BRET Assays: Detect protein interactions in living cells

    • Proximity Labeling: Use BioID or APEX2 fusions to label proteins in proximity to tmem50

    • Co-localization Studies: Visualize potential interactions using fluorescently tagged proteins

  • Computational Approaches:

    • Predict interaction partners based on co-evolution patterns

    • Molecular docking to model potential interaction interfaces

    • Network analysis to identify functional associations

  • Validation Strategies:

    • Confirm interactions using multiple independent methods

    • Perform mutagenesis to identify critical interaction residues

    • Assess functional consequences of disrupting specific interactions

For tmem50 specifically, leveraging the genetic tractability of Dictyostelium provides advantages for validating interactions in vivo and assessing their functional significance.

What are common challenges in reconstituting functional tmem50 and how can they be addressed?

Reconstituting membrane proteins like tmem50 into artificial membrane systems presents specific challenges that require methodical approaches to overcome:

  • Protein Denaturation During Purification:

    • Problem: Loss of native structure during detergent solubilization

    • Solution: Screen multiple detergents (DDM, LMNG, GDN); use milder solubilization conditions; add stabilizing agents like glycerol or specific lipids

  • Incomplete Detergent Removal:

    • Problem: Residual detergent interferes with membrane insertion

    • Solution: Use Bio-Beads or dialysis; verify detergent removal using analytical methods

  • Poor Incorporation into Liposomes:

    • Problem: Low efficiency of protein incorporation

    • Solution: Optimize lipid composition to match native membrane; try different reconstitution methods (detergent dialysis vs. direct incorporation)

  • Protein Orientation:

    • Problem: Random orientation in artificial membranes

    • Solution: Use oriented reconstitution techniques; verify orientation using protease protection assays

  • Aggregation During Reconstitution:

    • Problem: Protein aggregates rather than incorporates into membranes

    • Solution: Maintain protein in soluble state throughout procedure; optimize protein:lipid ratios; add specific lipids that promote stability

  • Quality Control Methods:

    • Dynamic light scattering to assess homogeneity

    • Freeze-fracture electron microscopy to visualize incorporation

    • Fluorescence recovery after photobleaching (FRAP) to assess mobility within membranes

    • Circular dichroism to confirm secondary structure maintenance

For functional studies, consider alternative membrane mimetics such as nanodiscs or amphipols that may better maintain protein structure and function compared to traditional liposomes.

How can researchers verify the integrity and proper folding of recombinant tmem50?

Ensuring the quality of purified tmem50 is essential before proceeding with functional or structural studies. Multiple complementary approaches should be used:

  • Biochemical Assessment:

    • SDS-PAGE and Western Blotting: Verify protein size and purity (should exceed 90%)

    • Size Exclusion Chromatography: Assess monodispersity and detect aggregation

    • Mass Spectrometry: Confirm protein identity and detect potential modifications

  • Structural Integrity:

    • Circular Dichroism: Analyze secondary structure content

    • Fluorescence Spectroscopy: Probe tertiary structure using intrinsic tryptophan fluorescence

    • Thermal Shift Assays: Measure protein stability under different conditions

    • Limited Proteolysis: Properly folded proteins show distinct proteolytic patterns

  • Functional Validation:

    • Ligand binding assays (if ligands are known)

    • Reconstitution into liposomes and functional testing

    • Comparison with native protein isolated from Dictyostelium

  • Membrane Insertion:

    • Detergent Resistance: Properly folded membrane proteins often show resistance to certain detergents

    • Lipid Binding Assays: Assess interaction with specific lipids

    • Tryptophan Fluorescence Quenching: Measure accessibility of tryptophan residues to water-soluble quenchers

A systematic approach combining multiple techniques provides the most reliable assessment of protein quality. Establishing quality control benchmarks early in a research project ensures consistency across experiments and improves reproducibility.

What are promising approaches for determining the function of tmem50?

Despite its presence in the Dictyostelium genome, the precise function of tmem50 remains uncharacterized. Several strategic approaches can help elucidate its role:

  • Genetic Approaches:

    • Generate knockout/knockdown strains using CRISPR-Cas9 or RNAi

    • Create conditional expression systems to study essential functions

    • Perform genetic screens to identify synthetic lethal or suppressor interactions

    • Use saturation mutagenesis to identify functionally critical residues

  • Phenotypic Characterization:

    • Assess effects on growth, development, and chemotaxis in Dictyostelium

    • Examine membrane organization and dynamics in modified strains

    • Investigate stress responses and adaptation to environmental changes

    • Study impacts on cell adhesion and multicellular development

  • Integrative Omics:

    • Perform transcriptomics and proteomics on tmem50-deficient cells

    • Use metabolomics to identify affected biochemical pathways

    • Apply phosphoproteomics to detect changes in signaling networks

  • Structural Biology:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Perform molecular dynamics simulations to predict functional movements

    • Use structure-guided mutagenesis to test functional hypotheses

  • Evolutionary Analysis:

    • Compare with homologs in other species where function may be better characterized

    • Identify co-evolving proteins as potential functional partners

Combining these approaches in an iterative manner, with each experiment informing the design of subsequent studies, provides the most promising path toward functional characterization.

How might advances in membrane protein structural biology impact tmem50 research?

Recent technological advances in membrane protein structural biology offer new opportunities for understanding tmem50:

  • Cryo-Electron Microscopy Advancements:

    • Single-particle cryo-EM now routinely achieves near-atomic resolution

    • Smaller membrane proteins (previously challenging) can now be resolved

    • Sample preparation improvements reduce artifacts

  • Integrative Structural Biology:

    • Combining multiple techniques (cryo-EM, crystallography, NMR, SAXS)

    • Computational methods to integrate diverse structural data

    • Molecular dynamics simulations in realistic membrane environments

  • Novel Membrane Mimetics:

    • Nanodiscs with defined size and composition

    • Polymer-based systems like SMALPs that extract membrane proteins with native lipids

    • Lipidic cubic phase innovations for crystallization

  • Applied Methods for tmem50:

    • Design optimized constructs with removable fusion partners

    • Screen lipid compositions that stabilize the protein

    • Use antibody fragments or nanobodies to stabilize specific conformations

  • Impact on Functional Understanding:

    • Structure determination could reveal potential binding sites

    • Conformational states might suggest transport or signaling mechanisms

    • Structural homology to proteins of known function could provide functional insights

The integration of these advanced structural biology approaches with functional studies provides a powerful framework for understanding the molecular basis of tmem50 function in cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.