Recombinant Dictyostelium discoideum Transmembrane protein 56 homolog B (tmem56c)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant tmem56c is synthesized using optimized protocols:

ParameterSpecification
Expression HostEscherichia coli (BL21 or similar strains)
Purity≥85%–90% (verified via SDS-PAGE)
FormulationLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
ReconstitutionRecommended in sterile water (0.1–1.0 mg/mL) with glycerol for long-term storage
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Biological and Functional Insights

While the exact role of tmem56c in Dictyostelium remains under investigation, homologs of transmembrane proteins in this organism are implicated in:

  • Chemotaxis and Cell Motility: Critical for studying immune cell migration and metastatic cancer mechanisms .

  • Autophagy and Lysosomal Function: Linked to neurodegenerative diseases like neuronal ceroid lipofuscinosis (NCL) via homologs such as TPP1 .

  • Mitochondrial Regulation: Insights into energy sensing pathways involving AMP-activated protein kinase (AMPK) .

Dictyostelium models have identified conserved pathways shared with humans, such as AMPK’s role in pathogen proliferation .

Research Applications

Recombinant tmem56c is utilized in:

  • Drug Discovery: Screening for compounds targeting transmembrane proteins involved in autophagy or lysosomal disorders .

  • Protein Interaction Studies: Identifying binding partners through pull-down assays or yeast two-hybrid systems .

  • Disease Modeling: Studying mitochondrial dysfunction and neurodegenerative conditions .

Commercial ELISA kits (e.g., CSB-CF703994DKK) leverage this protein for quantitative assays, highlighting its diagnostic potential .

Limitations and Future Directions

Current challenges include:

  • Limited functional annotation of tmem56c-specific pathways.

  • Need for structural studies (e.g., cryo-EM) to resolve transmembrane topology.

  • Exploration of compensatory mechanisms in knockout models .

Future research could link tmem56c to Dictyostelium developmental defects or human disease orthologs, leveraging its tractable genetics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your own practices.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tlcd4c; tmem56c; DDB_G0270414; TLC domain-containing protein 4 C; Transmembrane protein 56 homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tmem56c
Target Protein Sequence
MSSINGIDNIKFDYEFSNSLYYRNSIFFSIIFFIIYKKSSYITENFFGELVKKAYTTLTE KKKLEWDQRVVSMIHAFLVLPFCIISAVESFKYGDIFYFQNDSLLMVLSISSGYFIWDLI ICYKDPKLVGTPMIIHAIMGLSSNIYVALPHGRPCFVPIVAILLITEISTIPLNMKGFIQ VVNSKSKYYNWSLGAFVITFLVSRCIIGLPFDIYLVYGCIQRWDVFPMDKSLVFITECGI QFFLNSYWSFLLIKKLYQTYLNPIPNHKKNED
Uniprot No.

Target Background

Database Links
Protein Families
TMEM56 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism in TMEM56C studies?

Dictyostelium discoideum is a social amoeba that serves as a powerful model organism due to its unique life cycle, which includes both unicellular and multicellular stages. It has gained prominence in membrane protein research for several key reasons:

  • It possesses a fully sequenced, haploid genome with low redundancy, making genetic manipulations more straightforward than in complex eukaryotes

  • Its 24-hour developmental cycle allows rapid detection of phenotypes associated with membrane protein functions

  • It shares many conserved signaling pathways with higher eukaryotes while maintaining a less complex system

  • Its genome encodes numerous homologs of proteins involved in sensing and responding to microbes, similar to macrophages

The life cycle involves a transition from free-living unicellular amoebae to multicellular aggregates that form structures including mounds, slugs, and ultimately fruiting bodies with spore-containing structures held aloft by stalks of dead cells . This developmental progression makes it ideal for studying membrane protein dynamics during cellular differentiation.

What are the optimal storage and reconstitution conditions for recombinant TMEM56C?

For optimal activity retention and stability, the following storage and reconstitution protocols are recommended:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to prevent repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (recommended final concentration 50%) and aliquot for long-term storage at -20°C/-80°C

Storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

It is crucial to avoid repeated freeze-thaw cycles as this significantly reduces protein activity. For experimental reproducibility, consistent reconstitution and storage methods should be maintained across all studies.

Advanced Research Questions

Several complementary methodological approaches can be employed to study TMEM56C function during Dictyostelium development:

  • Gene knockout and expression analysis:

    • Generate TMEM56C knockout strains using CRISPR/Cas9 or homologous recombination

  • Developmental phenotype analysis:

    • Monitor all stages of development including aggregation, mound formation, slug formation, and culmination

    • Compare developmental timing between wild-type and mutant strains using fluorescent reporter strains that mark specific developmental stages

    • Quantify the proportions of different cell types (e.g., stalk vs. spore cells) using cell-type specific markers

  • Fluorescent protein tagging for localization studies:

    • Clone TMEM56C into expression vectors with GFP or RFP tags

    • Transform Dictyostelium cells and analyze subcellular localization during different developmental stages

  • Phospholipid scrambling assays:

    • Measure phosphatidylserine exposure using Annexin V binding assays in wild-type vs. TMEM56C mutant cells

    • Analyze developmental phenotypes in the context of phospholipid asymmetry, particularly during stalk cell differentiation, where PtdSer exposure increases

  • Transcriptomic and proteomic analysis:

    • Apply paired transcriptomics and proteomics during developmental time course

    • Analysis typically reveals a time lag of approximately 2-4 hours between mRNA and protein dynamics

    • Correlation between transcriptome and proteome decreases significantly as multicellular aggregation is initiated

What role might TMEM56C play in Dictyostelium cell-autonomous defense mechanisms?

TMEM56C likely contributes to Dictyostelium's cell-autonomous defense mechanisms, particularly in the context of host-pathogen interactions. Several lines of evidence suggest potential functions:

  • Phagosome maturation pathway involvement:
    Dictyostelium serves as a model phagocyte for studying cell-autonomous defenses against intracellular pathogens. The phagosome maturation pathway in Dictyostelium is highly conserved with mammalian phagocytes and follows distinct stages (Figure 1):

    • Initial bacteria recognition by phagocytic receptors

    • Phagosome formation and closure

    • Acquisition of early phagosomal markers (Rab5)

    • Rapid recruitment of Rab7, enabling fusion with lysosomes

    • Acidification via V-ATPase proton pumps

    • Delivery of lysosomal enzymes for bacterial degradation

    As a transmembrane protein, TMEM56C may participate in one or more of these stages, potentially in membrane remodeling or protein trafficking.

  • Phospholipid scrambling during immune responses:
    Since TMEM56C functions as a phospholipid scramblase , it may play a role in:

    • Exposing phosphatidylserine during bacterial engulfment

    • Membrane remodeling during phagosome maturation

    • Signaling during sentinel cell activity in multicellular stages

  • Potential involvement in bacteriolytic activity:
    Dictyostelium possesses bacteriolytic proteins that function optimally at acidic pH, creating antimicrobial environments within phagosomes:

    • Bacteriolytic activity occurs at very acidic pH (approximately 2), mimicking conditions in Dictyostelium phagosomes

    • This activity involves lysosomal proteins delivered to maturing phagosomes

    • TMEM56C might contribute to the transport or function of these bacteriolytic proteins

Research approaches to investigate this function could include:

  • Bacterial survival assays comparing wild-type and TMEM56C-deficient Dictyostelium

  • Colocalization studies with known phagosomal markers

  • Phospholipid scrambling assays during phagocytosis using fluorescent lipid probes

  • Proteomic analysis of phagosome composition in wild-type vs. TMEM56C knockout cells

What are the challenges and solutions in expressing functional TMEM56C in heterologous systems?

Expression of Dictyostelium proteins in heterologous systems presents several challenges, as demonstrated by attempts to express DdTMEM16 in mammalian systems :

Challenges and their solutions:

  • Codon usage differences:

    • Challenge: Dictyostelium has extremely low GC content (approximately 23%) compared to mammalian systems (around 60%)

    • Solution: Synthesize "humanized" genes adapted to human codon usage while maintaining the same amino acid sequence

    Example methodology:

    • Gene synthesis services (e.g., GeneArt from Life Technologies) can optimize codon usage

    • Clone the synthesized sequence into mammalian expression vectors (e.g., pcDNA6.2/EmGFP or pIRES-EGFP)

  • Subcellular localization verification:

    • Challenge: Ensuring proper membrane localization in heterologous systems

    • Solution: Multiple complementary approaches:

      • Confocal microscopy with GFP fusion proteins

      • Cell surface biotinylation assays using membrane-impermeable Sulfo-NHS-SS-Biotin

      • Western blot analysis of biotinylated plasma membrane proteins

  • Functional assessment:

    • Challenge: Determining whether the protein retains its native function

    • Solution:

      • For ion channel activity: whole-cell patch-clamp recordings under various conditions

      • For scramblase activity: phosphatidylserine exposure assays using fluorescently labeled Annexin V

      • Comparison with native protein function in Dictyostelium cells

  • Lipid environment requirements:

    • Challenge: Dictyostelium proteins may require specific lipid compositions for proper function

    • Solution:

      • Test function in different lipid environments by modifying membrane composition

      • Reconstitute purified protein in lipid bilayers with varying compositions

      • Consider that function may be highly susceptible to experimental conditions

  • Protein purification:

    • Challenge: Maintaining protein stability during extraction and purification

    • Solution:

      • Use mild detergents for membrane protein solubilization

      • Include protease inhibitors and optimize buffer conditions

      • Consider purification under native conditions using affinity tags

How can multi-omics approaches be utilized to understand TMEM56C function in Dictyostelium development?

Multi-omics approaches offer powerful tools for understanding TMEM56C function within the broader context of Dictyostelium development. Recent studies have employed paired transcriptomic and proteomic analyses during the transition from unicellular to multicellular stages :

Methodological framework for TMEM56C multi-omics investigation:

  • Temporal transcriptomic analysis:

    • Perform mRNA sequencing on wild-type and TMEM56C-deficient cells at 2-hour intervals during development

    • Recent findings demonstrate that the majority of transcripts are differentially expressed during development

    • Identify co-regulated gene networks associated with TMEM56C expression

  • Integrated proteomics:

    • Quantify approximately one-third of the proteome during early multicellular development

    • Special attention to membrane proteome changes using specialized extraction methods

    • Compare protein abundance patterns between wild-type and TMEM56C mutant strains

  • Correlation analysis:

    • Analyze transcriptome-proteome correlation, which is typically high during steady-state but decreases when multicellular aggregation is initiated

    • Identify the expected 2-4 hour time lag between TMEM56C mRNA expression and protein levels

    • Map TMEM56C into regulatory networks based on correlation patterns

  • Functional genomics integration:

    • Create insertional mutant libraries to facilitate pharmacogenetic screens

    • Perform genetic suppressor screens to identify pathways that interact with TMEM56C

    • Apply genome-wide CRISPR screening to identify synthetic interactions

  • Single-cell approaches:

    • Utilize single-cell RNA sequencing during aggregation to examine cell-type specific expression

    • Apply spatial transcriptomics to map TMEM56C expression patterns in multicellular structures

    • Integrate with lineage tracing to determine descendant cell fates

This multi-omics approach would provide comprehensive insights into TMEM56C function within developmental regulatory networks and cellular differentiation pathways.

What research applications could benefit from using recombinant TMEM56C protein?

Recombinant TMEM56C offers valuable research applications across multiple fields:

  • Structural biology studies:

    • Crystallization trials to determine three-dimensional structure

    • Cryo-electron microscopy analysis of membrane protein architecture

    • Structure-function relationship studies through site-directed mutagenesis

  • Antibody development:

    • Generation of specific antibodies for immunolocalization studies

    • Development of tools to track endogenous TMEM56C during development

    • Creation of blocking antibodies to study protein function

  • Phospholipid scrambling mechanism studies:

    • In vitro reconstitution in artificial membranes

    • Kinetic analysis of lipid scrambling activity

    • Comparison with other scramblases to identify conserved mechanisms

  • Protein-protein interaction studies:

    • Affinity purification coupled with mass spectrometry to identify binding partners

    • Yeast two-hybrid screening to identify cytoplasmic interactors

    • Co-immunoprecipitation assays to validate interactions in Dictyostelium cells

  • Drug discovery applications:

    • High-throughput screening for compounds that modulate TMEM56C activity

    • Development of phospholipid scramblase inhibitors with potential therapeutic applications

    • Target identification for anti-amoebic compounds

For researchers interested in implementing these applications, recombinant TMEM56C can be produced using the following methodology, based on protocols established for similar Dictyostelium membrane proteins:

Production methodology:

  • Clone the full-length coding sequence into a bacterial expression vector with an N-terminal His tag

  • Express in E. coli under optimized conditions

  • Purify using Ni-NTA affinity chromatography under native conditions

  • Verify purity by SDS-PAGE (>90% purity expected)

  • Store as lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

This approach yields high-quality protein suitable for diverse biochemical and functional studies.

How does TMEM56C contribute to our understanding of membrane protein evolution?

TMEM56C provides valuable insights into membrane protein evolution across eukaryotes, particularly regarding the diversification of TMEM16 family proteins:

Phylogenetic analysis places Dictyostelium TMEM16 at a crucial evolutionary position:

  • Dictyostelium represents the amoebozoa group that diverged from metazoa after plants but before fungi

  • Dictyostelium TMEM16 has higher sequence similarity to mammalian TMEM16 proteins than Saccharomyces Ist2p, making it more basal in the eukaryotic tree than previously studied homologs

The evolutionary trajectory of TMEM16 function appears to be:

  • Ancient function as phospholipid scramblases (as seen in Dictyostelium)

  • Retention of scramblase activity in many family members across evolution

  • Acquisition of ion channel function in some family members, particularly in vertebrates

This pattern suggests that Cl⁻ conductance of TMEM16 homologs from different animals likely represents a specialized innovation that emerged to meet the needs of complex organisms .

Comparative transmembrane topology analysis reveals:

  • TMEM16A and TMEM16B have similar topologies with relatively large extracellular loops between TM1/TM2 and TM9/TM10

  • TMEM16F and Drosophila Subdued share similar topologies

  • These extracellular loops are shorter in TMEM16K and non-vertebrate TMEM16 isoforms

  • Ancient TMEM16 homologs from Dictyostelium and yeasts have arrangements most similar to vertebrate TMEM16Ks

Research methodologies to further investigate evolutionary relationships include:

  • Sequence alignment analysis using tools like CLC workbench

  • Phylogenetic tree construction to place TMEM56C in evolutionary context

  • Functional complementation studies across species

  • Domain swapping experiments to identify key regions for specific functions

What is the relationship between TMEM56C and development in Dictyostelium discoideum?

The relationship between TMEM56C and Dictyostelium development likely intersects with two key aspects of the developmental process:

  • Phospholipid membrane asymmetry during development:

    • Extracellular exposure of phosphatidylserine (PtdSer) occurs during stalk cell differentiation in Dictyostelium

    • There is a gradual increase in PtdSer-exposing cells restricted to prestalk cells

    • Since only presumptive stalk cells show this change in membrane asymmetry, PtdSer exposure appears to be an important regulator of early development

    • As a phospholipid scramblase, TMEM56C may directly mediate this critical process

  • Cell fate determination and patterning:

    • Dictyostelium development involves differentiation into distinct cell types (prespore and prestalk)

    • Cell fate decisions are influenced by multiple factors including:

      • Cell cycle position at the time of starvation

      • Nutritional history

      • Genetic background

      • Ploidy status

    • TMEM56C may contribute to establishing membrane asymmetries that influence cell fate decisions

Experimental approaches to study this relationship:

  • Cell-type specific expression analysis:

    • Generate reporter constructs with GFP under the control of the TMEM56C promoter

    • Monitor expression patterns during development

    • Compare with established prestalk (ecmA) and prespore (pspA) markers

  • Chimeric development assays:

    • Mix wild-type and TMEM56C-knockout cells at defined ratios

    • Label populations with different fluorescent markers (RFP or vital dyes like CFSE)

    • Analyze the contribution of each population to different regions of multicellular structures

  • Phospholipid dynamics assessment:

    • Monitor phosphatidylserine exposure during development using fluorescent Annexin V

    • Compare patterns between wild-type and TMEM56C-deficient strains

    • Correlate with expression of cell-type specific markers

These approaches would establish whether TMEM56C-mediated phospholipid scrambling plays a direct role in developmental processes and cell fate decisions during Dictyostelium's multicellular phase.

What techniques are most effective for studying TMEM56C protein interactions?

Several complementary techniques can be employed to effectively study TMEM56C protein interactions:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express TMEM56C with affinity tags (His, FLAG, or ALFA tag)

    • Solubilize membranes with mild detergents (e.g., n-dodecyl-β-D-maltoside)

    • Purify TMEM56C and associated proteins using appropriate affinity matrices

    • Identify interacting partners by mass spectrometry

    • Validate using reciprocal pull-downs with identified partners

    Example protocol elements:

    • For membrane protein isolation, use cell surface biotinylation with membrane-impermeable Sulfo-NHS-SS-Biotin

  • Proximity labeling approaches:

    • Generate fusion proteins with BioID or APEX2 proximity labeling enzymes

    • Express in Dictyostelium cells during different developmental stages

    • Identify proteins in close proximity to TMEM56C through biotinylation

    • This approach is particularly valuable for membrane proteins with transient interactions

  • Co-localization studies:

    • Generate fluorescently tagged TMEM56C and candidate interacting proteins

    • Perform confocal microscopy during different stages of the Dictyostelium life cycle

    • Analyze co-localization using quantitative image analysis

    • Apply super-resolution microscopy techniques for detailed spatial analysis

  • Functional interaction screening:

    • Perform genetic suppressor screens with TMEM56C mutants

    • Identify genetic interactions through synthetic phenotype analysis

    • Use insertional mutant libraries to systematically identify functional interactors

  • Lipid-protein interaction analysis:

    • Use lipidomics approaches to identify lipids that interact with TMEM56C

    • Perform lipid binding assays with purified protein

    • Analyze the impact of specific lipids on TMEM56C scramblase activity

    • This is particularly relevant given that TMEM16 protein function is highly dependent on lipid environment

Each of these approaches has strengths and limitations; combining multiple methods provides the most comprehensive understanding of TMEM56C protein interactions in their biological context.

How can researchers address experimental challenges when working with TMEM56C?

Researchers working with TMEM56C face several experimental challenges specific to membrane proteins and Dictyostelium biology. The following methodological approaches can address these challenges:

  • Protein expression and purification challenges:

    • Challenge: Low expression levels and protein instability

    • Solutions:

      • Optimize codon usage for the expression system (e.g., "humanize" for mammalian expression)

      • Use specialized expression vectors with strong, inducible promoters

      • Add stabilizing fusion partners or tags

      • Include protease inhibitors during all purification steps

      • Optimize buffer conditions (pH, salt concentration, glycerol content)

  • Functional assay development:

    • Challenge: Assessing scramblase activity quantitatively

    • Solutions:

      • Develop fluorescence-based assays using NBD-labeled phospholipids

      • Quantify phosphatidylserine exposure using Annexin V binding with careful controls

      • Use purified protein reconstituted in liposomes for controlled functional studies

      • Compare with established scramblases as positive controls

  • Genetic manipulation in Dictyostelium:

    • Challenge: Creating precise genetic modifications

    • Solutions:

      • Apply CRISPR/Cas9 techniques optimized for Dictyostelium

      • Use established selection markers (e.g., G418 resistance at 10-30 μg/mL)

      • Verify modifications by genomic PCR and sequencing

      • Confirm protein expression changes by western blot

  • Developmental phenotype analysis:

    • Challenge: Distinguishing direct vs. indirect effects on development

    • Solutions:

      • Use inducible expression systems to control timing of protein expression/depletion

      • Perform careful time-course analyses with appropriate controls

      • Analyze chimeric developments with wild-type cells

      • Apply quantitative measurements of developmental timing and cell-type proportions

  • Addressing redundancy:

    • Challenge: Functional redundancy with other membrane proteins

    • Solutions:

      • Generate multiple knockout strains targeting related proteins

      • Perform complementation studies with various TMEM family members

      • Use domain-swapping experiments to identify functionally important regions

      • Apply systematic protein-protein interaction mapping to identify common pathways

  • Reproducibility considerations:

    • Challenge: Experimental variation in Dictyostelium studies

    • Solutions:

      • Standardize growth conditions (axenic medium composition, cell density)

      • Use consistent developmental induction protocols

      • Include appropriate controls in every experiment

      • Apply quantitative measurements with statistical analysis

      • Document detailed methodology including strain background, growth conditions, and exact experimental parameters

By systematically addressing these challenges, researchers can generate robust and reproducible data on TMEM56C structure, function, and biological roles.

What are promising future research directions for TMEM56C studies?

Based on current knowledge gaps and technological capabilities, several promising research directions for TMEM56C studies emerge:

  • High-resolution structural studies:

    • Apply cryo-electron microscopy to determine the 3D structure of TMEM56C

    • Compare with structures of other TMEM16 family members to identify conserved and divergent features

    • Use molecular dynamics simulations to understand membrane interactions and lipid scrambling mechanisms

    • Develop structure-based models of scramblase function

  • Developmental regulation mechanisms:

    • Investigate the transcriptional and post-translational regulation of TMEM56C during Dictyostelium development

    • Identify specific signaling pathways that modulate TMEM56C expression and function

    • Determine whether phospholipid scrambling directly contributes to developmental signaling

    • Map the spatiotemporal activity of TMEM56C during multicellular development using biosensors

  • Evolutionary comparative studies:

    • Extend comparisons to TMEM16 homologs across diverse eukaryotic lineages

    • Reconstruct the ancestral function of TMEM16 proteins

    • Test evolutionary hypotheses through complementation studies across species

    • Identify critical adaptations that led to functional diversification

  • Immune function investigations:

    • Characterize the role of TMEM56C in bacterial phagocytosis and killing

    • Test susceptibility of TMEM56C-deficient Dictyostelium to various bacterial pathogens

    • Investigate potential roles in phagosome maturation and bacteriolytic activity

    • Develop TMEM56C-based tools for studying phospholipid dynamics during immune responses

  • Applications in synthetic biology:

    • Engineer TMEM56C variants with modified scramblase properties

    • Develop controlled phospholipid scrambling systems for biotechnological applications

    • Create chimeric proteins combining domains from different TMEM16 family members

    • Explore potential applications in drug delivery or biosensor development

  • Integration with cell fate determination studies:

    • Investigate how phospholipid scrambling correlates with cell fate decisions

    • Determine whether TMEM56C activity influences the stalk/spore cell ratio

    • Test whether artificial manipulation of phospholipid asymmetry can alter developmental outcomes

    • Develop single-cell approaches to track membrane asymmetry during development

These research directions would significantly advance our understanding of TMEM56C biology while potentially yielding insights applicable to broader questions in cell biology, development, and evolution.

How might TMEM56C research contribute to broader understanding of human disease mechanisms?

TMEM56C research in Dictyostelium has potential implications for understanding several human disease mechanisms, particularly those involving membrane dynamics and phospholipid asymmetry:

  • Neurodegenerative diseases:

    • Dictyostelium serves as a model for studying protein quality control pathways that prevent aggregation

    • TMEM56C-mediated membrane remodeling may influence protein aggregation processes

    • Insights could help develop therapies for polyglutamine-related disorders like Huntington's disease

    • Specific approaches include:

      • Testing whether TMEM56C affects protein aggregation kinetics

      • Investigating membrane-associated protein quality control mechanisms

      • Screening for compounds that modulate TMEM56C activity and affect aggregation

  • Immune system disorders:

    • Disrupted phospholipid scrambling is associated with several human immunological disorders

    • TMEM16F mutations cause Scott syndrome, a bleeding disorder due to defective phosphatidylserine exposure in platelets

    • TMEM56C research could illuminate fundamental mechanisms of scramblase function relevant to these conditions

    • Specific approaches include:

      • Comparative functional studies between TMEM56C and human TMEM16F

      • Analysis of conserved structural elements required for scramblase activity

      • Development of small molecule modulators of scramblase function

  • Infectious diseases:

    • Dictyostelium is an established model for studying host-pathogen interactions

    • TMEM56C may participate in pathways similar to those involved in human macrophage responses to pathogens

    • Findings could lead to novel therapeutic approaches targeting membrane dynamics during infection

    • Specific approaches include:

      • Testing TMEM56C involvement in resistance to specific pathogens

      • Investigating whether bacterial pathogens target TMEM56C function

      • Developing compounds that enhance antimicrobial functions

  • Cancer biology:

    • Altered phospholipid asymmetry is a hallmark of many cancer cells

    • Understanding TMEM56C function could provide insights into mechanisms of membrane remodeling in cancer

    • Potential applications in developing scramblase-targeting cancer therapies

    • Specific approaches include:

      • Comparative studies of scramblase activity in normal vs. cancer cells

      • Investigation of phospholipid asymmetry in cell migration and invasion

      • Testing whether scramblase modulators affect cancer cell behavior

By leveraging the experimental advantages of the Dictyostelium model system, TMEM56C research can provide fundamental insights into membrane protein function that may ultimately contribute to our understanding of human disease mechanisms and the development of novel therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.