Recombinant Dictyostelium discoideum Transmembrane protein 93 homolog (tmem93)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
emc6; tmem93; DDB_G0280399; ER membrane protein complex subunit 6; Transmembrane protein 93
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
emc6
Target Protein Sequence
MLHPQQMQEQQQQQQEAQAASIIPEHYEMEYIQRNNKTVSFCQIPISILGGAIAGVIGFS GVYGFLFYFFIYITFCSLFTLKENKNLHLYFPNPRSIWFDSIGAGLMPYILFWTFLYNII HIY
Uniprot No.

Target Background

Function

This protein is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. It exhibits a preference for proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. This protein is involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. It is also essential for the post-translational insertion of tail-anchored (TA) proteins into the ER membrane. By mediating the correct co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), it controls the topology of multi-pass membrane proteins. Through its regulation of protein membrane insertion, it indirectly influences numerous cellular processes.

Database Links
Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Dictyostelium discoideum tmem93?

Dictyostelium discoideum tmem93 is a transmembrane protein consisting of 123 amino acids with the sequence: mLHPQQMQEQQQQQQEAQAASIIPEHYEMEYIQRNNKTVSFCQIPISILGGAIAGVIGFSGVYGFLFYFFIYITFCSLFTLKENKNLHLYFPNPRSIWFDSIGAGLMPYILFWTFLYNIIHIY. It is classified as a homolog of the transmembrane protein 93 family and is encoded by the gene tmem93 (ORF name: DDB_G0280399). The protein contains transmembrane domains with characteristic hydrophobic regions interspersed with polar and charged residues, which are critical for its membrane integration and function .

How is tmem93 related to the ER membrane protein complex (EMC)?

Dictyostelium discoideum tmem93 is a homolog of EMC6 (ER membrane protein complex subunit 6) in humans and other organisms. The EMC is a conserved multi-subunit complex involved in membrane protein biogenesis and integration. Proteomic analyses have shown that tmem93/EMC6 plays a crucial role in handling transmembrane domains (TMDs) with polar and/or charged residues that are challenging for membrane integration. The protein functions within the complex to assist with proper folding and insertion of specific membrane proteins .

What are the optimal conditions for expressing recombinant tmem93 in laboratory settings?

For optimal expression of recombinant Dictyostelium discoideum tmem93, a cell-free expression system is typically preferred as indicated by multiple commercial sources. The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week. It's critical to avoid repeated freeze-thaw cycles that may compromise protein integrity. For purification, protocols that achieve greater than 85% purity as determined by SDS-PAGE are standard. When designing expression constructs, consider including affinity tags such as His or GST to facilitate purification .

What methods can be used to verify the membrane topology of recombinant tmem93?

To determine the membrane topology of recombinant tmem93, epitope tagging combined with differential permeabilization techniques is effective. Create two versions of tmem93 with epitope tags (e.g., HA) on either the N-terminus or C-terminus. After expression, use selective membrane permeabilization with:

  • Saponin (permeabilizes both plasma membrane and ER/Golgi membranes)

  • Digitonin (selectively permeabilizes only the plasma membrane)

Following permeabilization, perform immunofluorescence using anti-epitope antibodies. The accessibility of the epitope under different permeabilization conditions reveals the orientation of the protein domains relative to the membrane. This approach has been successful for other membrane proteins in Dictyostelium and can be applied to tmem93 .

How does tmem93 contribute to membrane protein homeostasis in Dictyostelium discoideum?

Tmem93, as part of the EMC complex, plays a critical role in membrane protein homeostasis by facilitating the integration of transmembrane domains containing polar and/or charged residues. Proteomic analysis comparing EMC-deficient cells to wild-type cells has identified specific membrane proteins that depend on the EMC for proper expression and localization. The EMC, including tmem93/EMC6, functions as a membrane protein insertase that assists in the biogenesis of multi-pass membrane proteins with challenging TMDs. Additionally, it may serve as a holdase that prevents aggregation of membrane proteins during their synthesis and integration. In Dictyostelium, this function is particularly important given the organism's complex membrane dynamics during its life cycle transitions between unicellular and multicellular states .

How can recombinant tmem93 be used to study protein aggregation disorders?

Dictyostelium discoideum has been identified as a unique model organism with an unusual capacity to resist protein aggregation, including proteins with long polyglutamine tracts that typically form aggregates in human neurodegenerative diseases. Recombinant tmem93, as a component of the membrane protein quality control system, can be studied to understand how Dictyostelium suppresses protein aggregation. By comparing wild-type and tmem93-mutant cells expressing aggregation-prone proteins (such as polyglutamine-expanded Huntingtin), researchers can determine whether tmem93 contributes to this protective capacity. This approach can provide insights into potential therapeutic strategies for protein aggregation disorders like Huntington's disease .

What is the significance of using tmem93 in Dictyostelium as a model for human neurodegenerative diseases?

Dictyostelium has emerged as a valuable model for studying human neurodegenerative diseases due to its conservation of many fundamental cellular pathways while offering experimental advantages like genetic tractability and rapid growth. Tmem93, as a component of the ER membrane protein complex, is involved in protein quality control mechanisms that are often compromised in neurodegenerative diseases. Research has shown that Dictyostelium can be used to model conditions like Batten disease, Parkinson's disease, and other disorders involving protein misfolding. By studying tmem93 function in this context, researchers can gain insights into how membrane protein integration affects disease progression. The simplicity of Dictyostelium combined with its conservation of key pathways makes it an excellent system for initial drug screening and pathway discovery before moving to more complex models .

How does Dictyostelium tmem93 compare structurally and functionally to its human homolog EMC6/TMEM93?

A comparative analysis of Dictyostelium tmem93 and human EMC6/TMEM93 reveals both conservation and divergence:

FeatureDictyostelium tmem93Human EMC6/TMEM93
Length123 amino acids110 amino acids
Cellular localizationER membraneER membrane
Complex formationComponent of EMCComponent of EMC
FunctionMembrane protein integrationMembrane protein integration
Unique featuresContains glutamine-rich region at N-terminusLacks extended glutamine-rich region
Transmembrane domainsMultiple hydrophobic regionsMultiple hydrophobic regions

Despite differences in primary sequence, both proteins share functional conservation as components of the EMC, assisting in the integration of challenging transmembrane domains. The glutamine-rich region in Dictyostelium tmem93 may be related to the organism's unusual capacity to handle proteins with glutamine-rich regions without aggregation .

What advantages does the Dictyostelium model offer for studying tmem93 function compared to mammalian cell models?

Studying tmem93 in Dictyostelium offers several key advantages over mammalian cell models:

  • Genetic tractability: Dictyostelium has a haploid genome, allowing researchers to introduce one or multiple gene disruptions with relative ease, facilitating functional studies of tmem93 and potential genetic interactions.

  • Reduced genetic redundancy: The Dictyostelium genome has less redundancy than mammalian genomes, making it easier to observe phenotypes when disrupting single genes.

  • Developmental context: Dictyostelium transitions between unicellular and multicellular states, providing a unique context to study tmem93 function in different cellular environments within the same organism.

  • Conservation of key pathways: Despite its evolutionary distance from mammals, Dictyostelium maintains many of the fundamental cellular processes found in higher eukaryotes.

  • Rapid experimental timeline: The 24-hour developmental cycle of Dictyostelium allows for quick assessment of phenotypes, compared to the much longer timelines required for mammalian development studies.

These advantages make Dictyostelium an ideal model system for initial characterization of tmem93 function, with findings potentially translatable to more complex mammalian systems .

How can CRISPR-Cas9 technologies be optimized for generating targeted mutations in Dictyostelium tmem93?

CRISPR-Cas9 genome editing in Dictyostelium requires specific optimizations for targeting tmem93:

  • Guide RNA design: Target unique regions of the tmem93 gene (DDB_G0280399) with minimal off-target potential. The gene's AT-rich nature (characteristic of Dictyostelium) requires careful guide selection, preferably with GC content >40% in the guide sequence.

  • Expression system: Utilize Dictyostelium-specific promoters (such as actin15) for Cas9 and guide RNA expression. Extrachromosomal plasmids with G418 resistance are effective for transient expression.

  • Homology-directed repair: For precise mutations, design homology arms of 500-1000bp flanking the cut site. When introducing tag sequences, place them at the C-terminus to minimize disruption of membrane integration.

  • Verification strategy: Implement a multi-step verification process:

    • PCR screening of transformants

    • Sequencing to confirm mutations

    • Western blot analysis to verify protein expression or absence

    • Functional assays to assess membrane integration

  • Phenotypic rescue: Include parallel experiments with wild-type tmem93 expression constructs to confirm phenotype specificity.

This approach has been successfully applied to other membrane proteins in Dictyostelium and can be adapted for tmem93 studies .

How can researchers investigate the dynamic interactome of tmem93 during Dictyostelium development?

To investigate the dynamic interactome of tmem93 during Dictyostelium development, researchers can implement a multi-faceted approach:

  • Time-resolved proximity labeling: Express tmem93 fused to BioID or APEX2 under an inducible promoter. Activate labeling at specific developmental timepoints (0h, 6h, 12h, 18h, 24h), followed by streptavidin pulldown and mass spectrometry to identify stage-specific interaction partners.

  • Fluorescence correlation spectroscopy: Create tmem93-GFP fusions to monitor protein dynamics and complex formation in living cells throughout development.

  • Co-immunoprecipitation with crosslinking: Use membrane-permeable crosslinkers to capture transient interactions before cell lysis and immunoprecipitation, followed by mass spectrometry analysis.

  • Genetic interaction screens: Generate tmem93 mutants combined with mutations in other EMC components or interacting proteins to identify synthetic phenotypes during development.

  • Quantitative phosphoproteomics: Examine post-translational modifications of tmem93 and its interactors at different developmental stages to understand regulation.

This comprehensive approach would reveal how tmem93's interactions change during the transition from unicellular to multicellular stages, potentially uncovering novel roles in development beyond its established function in membrane protein integration .

What are common pitfalls when working with recombinant tmem93 and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Dictyostelium tmem93:

  • Protein aggregation: The transmembrane nature of tmem93 makes it prone to aggregation during purification. Address by:

    • Including 0.1-0.5% mild detergents (DDM or CHAPS) in all buffers

    • Maintaining temperature at 4°C throughout purification

    • Adding 10% glycerol to stabilize the protein

  • Low expression yields: Being a membrane protein, expression levels may be suboptimal. Improve by:

    • Testing multiple expression systems (cell-free systems often yield better results)

    • Optimizing codon usage for the expression system

    • Using fusion partners (SUMO, MBP) that enhance solubility

  • Improper folding: Verify proper folding through:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis assays to assess conformational stability

    • Functional assays that depend on proper protein conformation

  • Loss of activity during storage: Maintain functionality by:

    • Storing in 50% glycerol at -80°C

    • Avoiding repeated freeze-thaw cycles

    • Preparing small single-use aliquots

  • Difficult detection: For accurate quantification:

    • Use multiple detection methods (Western blot, silver stain, mass spectrometry)

    • Include epitope tags that don't interfere with protein function

    • Develop and validate specific antibodies for native protein detection

By anticipating these challenges, researchers can develop protocols that yield properly folded, functional recombinant tmem93 suitable for downstream applications .

How can researchers assess whether recombinant tmem93 retains its native conformation and functionality?

Assessing the native conformation and functionality of recombinant tmem93 requires multiple complementary approaches:

  • Structural analysis:

    • Circular dichroism spectroscopy to confirm predicted secondary structure elements

    • Size exclusion chromatography to verify monomeric state or appropriate complex formation

    • Limited proteolysis patterns compared to native protein

  • Membrane integration assays:

    • Microsome incorporation assays to test membrane insertion capability

    • Protease protection assays to confirm correct topology

    • Fluorescence microscopy with tagged constructs to verify ER localization

  • Functional complementation:

    • Rescue experiments in tmem93-knockout Dictyostelium cells

    • Assessment of EMC-dependent protein levels in complemented cells

    • Measurement of phenotypic rescue (growth rates, development, endocytosis)

  • Interaction verification:

    • Co-immunoprecipitation with known EMC components

    • Proximity labeling to identify interaction partners

    • Split-GFP assays to verify interactions in living cells

  • Comparative analysis:

    • Side-by-side assessment with native tmem93 in biochemical assays

    • Comparison of post-translational modifications

    • Thermal stability analysis compared to native protein

Only when recombinant tmem93 passes these quality control measures should it be used for further experimental applications or structural studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.