Recombinant Dictyostelium discoideum Transmembrane protein DDB_G0269096 (DDB_G0269096)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0269096; Transmembrane protein DDB_G0269096
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0269096
Target Protein Sequence
MEDRNLERNIGSDISSSSSIDMSQSTNLEISIDQSINRNLEKIDISEDDVRRGEKKIESF ENGENNNNNNNNNNNNNNNNNNNNNKNEDRKFKKTLFCIKMYIIQYFKKWLGTGKDKRPP IPDLEEIGWTWLASFTGILVLALIHYREALDAQMQVLIGSFAASAVIIFGVPKSPLAQPR NLIMGHFLSAVVGSVIRVALVYTNANFEVACALAVSLSIMLMQFTNSLHPPGGATALICV MGVEQRWRGFYFIFVPILSGALIMLLTALVVNNFARKRSYPLYWW
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DDB_G0269096 and what is its basic structure?

DDB_G0269096 is a transmembrane protein from the soil amoeba Dictyostelium discoideum. The full-length protein consists of 285 amino acids and is available as a recombinant protein with a His-tag expressed in E. coli systems . As a transmembrane protein, it contains hydrophobic domains that span the cell membrane, which presents specific challenges for expression and purification compared to soluble proteins. The protein's transmembrane nature suggests it likely plays a role in cellular signaling, transport processes, or intercellular interactions, though specific functions are still being characterized through ongoing research.

What expression systems are used for producing recombinant DDB_G0269096?

The primary expression system used for producing recombinant DDB_G0269096 is E. coli . The methodology typically involves:

  • Cloning the DDB_G0269096 gene into an appropriate expression vector containing a His-tag sequence

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under optimized conditions (temperature, induction time, media composition)

  • Cell lysis and protein extraction using detergents suitable for transmembrane proteins

  • Purification via affinity chromatography using the His-tag

For transmembrane proteins like DDB_G0269096, expression can face challenges including protein hydrophobicity, codon usage issues, and potential toxicity to the host cells . Alternative expression systems such as yeast, insect cells, or mammalian cells may be considered if E. coli expression yields are insufficient or if post-translational modifications are required for functional studies.

What is the significance of using Dictyostelium discoideum as a model organism?

Dictyostelium discoideum offers several advantages as a model organism for studying proteins like DDB_G0269096:

  • It is a haploid eukaryote with a well-characterized genome, making genetic manipulations straightforward

  • Upon starvation, it undergoes a developmental cycle to form multicellular fruiting bodies, allowing study of both single-cell and developmental processes

  • It serves as an excellent host model system for intracellular pathogens, particularly Legionella species

  • Various cellular markers and mutant strains are available, facilitating detailed mechanistic studies

  • Its relatively simple cultivation requirements make it accessible for most research laboratories

These characteristics make D. discoideum particularly valuable for investigating protein function in the context of cellular pathways, host-pathogen interactions, and developmental processes.

How can researchers determine the subcellular localization of DDB_G0269096?

Determining the subcellular localization of DDB_G0269096 requires a multi-faceted approach:

  • Fluorescent protein tagging: Generate constructs expressing DDB_G0269096 fused to fluorescent proteins (GFP, mCherry) to visualize localization in live cells. When designing these constructs, researchers must consider:

    • Tag position (N- or C-terminal) to minimize interference with transmembrane domains

    • Linker sequences to ensure proper protein folding

    • Expression levels to avoid artifacts from overexpression

  • Immunofluorescence microscopy: Develop specific antibodies against DDB_G0269096 or use antibodies against the His-tag for fixed-cell microscopy. This approach can be combined with co-staining for organelle markers.

  • Subcellular fractionation: Isolate different cellular compartments (plasma membrane, endosomes, lysosomes) through differential centrifugation followed by Western blot analysis to detect DDB_G0269096.

  • Co-localization studies: Examine whether DDB_G0269096 co-localizes with known markers. For instance, the research on Legionella infection in D. discoideum demonstrated techniques where GFP-tagged bacterial proteins were observed relative to lysosomal protein DdLIMP using confocal microscopy . Similar approaches can be applied to DDB_G0269096.

What techniques are most effective for studying protein-protein interactions involving DDB_G0269096?

Several complementary techniques can be employed to investigate protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against DDB_G0269096 or its tag to pull down the protein complex, followed by mass spectrometry analysis to identify interacting partners.

  • Proximity labeling methods: BioID or APEX2 fusions to DDB_G0269096 to identify proximal proteins in living cells.

  • Yeast two-hybrid screening: Though challenging for transmembrane proteins, modified membrane yeast two-hybrid systems can be employed.

  • FRET/BRET analysis: For studying interactions in live cells using fluorescent or bioluminescent protein pairs.

  • Cross-linking mass spectrometry: To capture transient interactions before cell lysis.

When reporting interaction data, researchers should present results in tabular format similar to the example below:

Interacting ProteinDetection MethodInteraction StrengthCellular CompartmentFunctional Significance
Protein XCo-IP/MSStrongPlasma membraneSignaling pathway activation
Protein YBioIDModerateEarly endosomesTrafficking regulation
Protein ZFRETWeakGolgi apparatusUnknown

How can genome editing approaches be used to study DDB_G0269096 function?

Modern genome editing techniques are particularly powerful in D. discoideum due to its haploid nature:

  • CRISPR-Cas9 gene knockout: Design guide RNAs targeting DDB_G0269096 to generate complete loss-of-function mutants. Phenotypic analysis should include:

    • Growth rate in various conditions

    • Development timing and morphology

    • Resistance/susceptibility to pathogens like Legionella

    • Changes in membrane composition or trafficking

  • Knockin mutations: Generate specific mutations to study structure-function relationships or add endogenous tags.

  • Conditional expression systems: For studying essential genes, use tetracycline-inducible or similar systems to control expression levels.

  • Complementation studies: Reintroduce wild-type or mutant versions of DDB_G0269096 into knockout strains to determine critical functional domains.

  • Transcriptomics analysis: Compare gene expression profiles between wild-type and DDB_G0269096-mutant cells to identify downstream pathways affected.

What are the best methods for purifying DDB_G0269096 while maintaining its native conformation?

Purifying transmembrane proteins like DDB_G0269096 requires specialized approaches:

  • Detergent screening: Test multiple detergents (DDM, CHAPS, digitonin) to identify optimal solubilization conditions that maintain protein structure.

  • Membrane mimetics: Consider nanodiscs, liposomes, or amphipols as alternatives to detergents for maintaining native conformation.

  • Purification strategy:

    • Solubilize membranes with selected detergent

    • Perform immobilized metal affinity chromatography (IMAC) using the His-tag

    • Consider size exclusion chromatography as a polishing step

    • Verify protein integrity through circular dichroism or thermal shift assays

  • Stabilization methods: Add specific lipids or stabilizing compounds identified through systematic screening.

  • Quality control: Utilize dynamic light scattering, negative-stain electron microscopy, and functional assays to confirm proper folding and homogeneity.

Researchers should be aware that expressing full-length transmembrane proteins faces challenges including protein hydrophobicity, codon usage optimization, and potential toxicity to expression hosts .

How can researchers design assays to investigate DDB_G0269096 function in host-pathogen interactions?

Building on D. discoideum's established role as a host model for Legionella infection , researchers can design experiments to investigate DDB_G0269096's potential role:

  • Infection assays with DDB_G0269096 mutants:

    • Generate DDB_G0269096 knockout or overexpression strains

    • Infect with pathogens like Legionella pneumophila

    • Quantify intracellular bacterial growth compared to wild-type cells

    • Analyze phagosome maturation and lysosomal fusion events

  • Co-localization studies during infection:

    • Use fluorescently-tagged DDB_G0269096 and pathogen markers

    • Employ time-lapse confocal microscopy to track dynamic interactions

    • Compare with known markers like DdLIMP (a lysosomal protein in D. discoideum)

  • Biochemical characterization:

    • Analyze post-translational modifications of DDB_G0269096 during infection

    • Identify changes in protein-protein interactions upon pathogen challenge

    • Investigate potential targeting by pathogen effector proteins

  • Developmental impact assessment:

    • Study how pathogen infection affects D. discoideum development when DDB_G0269096 is absent

    • Analyze whether DDB_G0269096 influences the inhibition of differentiation observed during Legionella infection

How should researchers present data from DDB_G0269096 functional studies?

Effective data presentation is crucial for transmitting research findings. Researchers should select the most appropriate format based on data type and analysis goals:

Data TypePresentation FormatJustificationExample for DDB_G0269096 Research
Precise numerical valuesTablesTo show many numerical values and specific data in a small space Protein expression levels across different conditions
Trends and relationshipsFigures/GraphsTo show patterns and relationships between datasets Changes in localization over time during infection
Simple findingsTextWhen data is limited or straightforward Basic protein characteristics
Comparative dataSide-by-side tablesTo compare data with several shared characteristics Wild-type vs. mutant phenotypes
Visual processesDiagrams/FlowchartsTo present visual explanations of sequences or procedures Proposed mechanism of DDB_G0269096 function

When creating tables, researchers should ensure that titles clearly describe content, column headings are descriptive, and tables are designed to be understood without reference to the text .

How can researchers address contradictory findings in DDB_G0269096 research?

When encountering contradictory results in research involving DDB_G0269096:

  • Methodological analysis:

    • Compare experimental protocols in detail, noting differences in:

      • Protein expression systems and purification methods

      • Cell culture conditions and developmental stages

      • Assay conditions and detection methods

      • Genetic backgrounds of D. discoideum strains used

  • Controlled validation experiments:

    • Design experiments that directly address the contradiction

    • Include positive and negative controls

    • Perform blinded analyses when possible

    • Use multiple complementary techniques to confirm findings

  • Systematic reporting:

    • Present contradictory findings transparently

    • Create comparison tables highlighting key differences

    • Discuss potential explanations for discrepancies

    • Outline experimental approaches to resolve contradictions

  • Collaboration:

    • Consider establishing collaborations with labs reporting different results

    • Exchange materials and protocols to identify sources of variation

    • Perform parallel experiments under standardized conditions

What emerging technologies could advance understanding of DDB_G0269096?

Several cutting-edge technologies hold promise for deeper insights into DDB_G0269096:

  • Cryo-electron microscopy: For determining high-resolution structures of DDB_G0269096 alone or in complex with interacting partners.

  • Single-cell proteomics: To understand cell-to-cell variation in DDB_G0269096 expression and localization during development or infection.

  • Advanced live-cell imaging:

    • Super-resolution microscopy for detailed localization studies

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

    • FRET sensors to detect conformational changes or interactions in real-time

  • Machine learning approaches: To predict protein-protein interactions, functional domains, or evolutionary relationships.

  • Synthetic biology tools: For creating optogenetic or chemogenetic versions of DDB_G0269096 to control its function with spatiotemporal precision.

How might DDB_G0269096 research contribute to broader understanding of eukaryotic biology?

Research on DDB_G0269096 has potential implications for multiple fields:

  • Evolutionary biology: Comparative analysis with homologs in other species could reveal conserved mechanisms in membrane protein evolution.

  • Cell biology: Insights into fundamental processes like membrane trafficking, signal transduction, or organelle biogenesis.

  • Host-pathogen interactions: Better understanding of how intracellular pathogens manipulate host cell machinery, potentially informing new therapeutic approaches.

  • Developmental biology: Clarification of how transmembrane proteins contribute to the transition from unicellular to multicellular states during D. discoideum development.

  • Biomedical applications: Knowledge gained from DDB_G0269096 studies might inform research on human transmembrane proteins involved in disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.