Recombinant Dictyostelium discoideum Transmembrane protein DDB_G0273707/DDB_G0273361 (DDB_G0273707)

Shipped with Ice Packs
In Stock

Description

Functional Groups in D. discoideum

  • Bacteriolytic Proteins:

    • BadA, BadB, BadC: Members of the DUF3430 domain family, critical for lysing ingested bacteria (e.g., Klebsiella pneumoniae) at acidic pH. Overexpression of BadA increases lytic activity by 40% in vitro .

    • Kil1/Kil2: Required for ionic balance in phagosomes and bacterial destruction .

  • Developmental Proteins:

    • SigN Family: Prestalk-specific small proteins (87–89 aa) involved in multicellular morphogenesis. Antibodies against these disrupt slug formation .

  • Recombinant Proteins:

    • DDB_G0276837: A 72-amino-acid His-tagged protein expressed in E. coli, with unknown function. Sequence: MSQNNLKFTEFLSNVKSKANSKGFMKLFDMYHRQVVVKKPFSFLVHIMCGLTLTSYVIRH DKVEHHKTQPYH .

Challenges in Studying DDB_G0273707/DDB_G0273361

FactorImplicationsMitigation Strategies
Annotation GapsLimited functional data for many D. discoideum transmembrane proteinsHomology-based prediction
Experimental ModelsLack of knockout/knock-in studies for DDB_G0273707/DDB_G0273361Reverse genetics (REMI)
Commercial AvailabilityNo recombinant forms of DDB_G0273707/DDB_G0273361 reportedCustom synthesis via E. coli

Proposed Experimental Approach

  1. Bioinformatics:

    • BLAST analysis against D. discoideum genome databases (dictyBase, NCBI Map Viewer) .

    • Domain prediction (e.g., DUF3430, transmembrane helices).

  2. Functional Studies:

    • Phagocytosis Assays: Measure bacteriolytic activity using K. pneumoniae mutants .

    • Developmental Knockdown: Assess multicellular defects during fruiting body formation .

  3. Protein Production:

    • Recombinant expression in E. coli or D. discoideum using His-tag systems .

Case Study: DDB_G0276837

ParameterValueReference
Length72 amino acids
TagN-terminal His-tag
Expression HostE. coli
Purity>90% (SDS-PAGE)
Sequence MotifHydrophobic regions suggesting membrane association

While DDB_G0273707/DDB_G0273361 remains uncharacterized, D. discoideum transmembrane proteins are pivotal in bacterial killing, development, and disease modeling. Prioritizing bioinformatics-driven hypotheses and functional assays (e.g., phagosome disruption) could elucidate their roles. Collaborations with commercial suppliers (e.g., CUSABIO, Creative Biomart) may accelerate recombinant production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0273707; DDB_G0273361; Transmembrane protein DDB_G0273707/DDB_G0273361
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0273707;
Target Protein Sequence
MNEIEVDNLSHTNKNVATDNINNNNNDIELETIPNDSNNSNNNNNNNNNNNNNNNNNNNN NNNSNSNDIELETEPNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNENNNKIKNEK INILLSIKLYFIQYFKKWKGGEKSPVRADLEEIGWSWLSSFIGILVLALLHYRVTVEKET IFLLGSFAASAVLIFGAPKSPLAQPRNLVLGHIVSATVGSIIRVALVYTNAQTEVACALA VSLAIVGMHFTKSIHPPGGATALICVMSAEQRWRGFYYIFVPVASGSLTMLLTALIVNNF ARKRKYPVFWW
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of DDB_G0273707/DDB_G0273361?

DDB_G0273707/DDB_G0273361 is a full-length transmembrane protein consisting of 311 amino acids derived from the social amoeba Dictyostelium discoideum . The protein is available as a His-tagged recombinant protein expressed in E. coli systems, which facilitates purification and experimental manipulation . This protein appears to be homologous to transmembrane protein 33 (tmem33) based on sequence analysis .

When working with this protein, researchers should consider that the His-tag may influence protein folding or function in some experimental contexts. For structural studies, it's advisable to compare results between tagged and untagged versions of the protein when possible, or to cleave the tag using appropriate proteases if the experimental design requires native protein structure.

How should DDB_G0273707/DDB_G0273361 be stored and handled for optimal stability?

While specific storage information for DDB_G0273707 is not detailed in the provided literature, recombinant proteins from Dictyostelium generally maintain stability when stored at -80°C in appropriate buffer conditions. The handling of this protein should follow standard protocols for transmembrane proteins, including avoiding repeated freeze-thaw cycles and maintaining appropriate detergent concentrations to prevent aggregation.

Given that Dictyostelium proteins demonstrate remarkable resistance to aggregation , DDB_G0273707 may exhibit better stability than homologous proteins from other organisms. Nevertheless, researchers should perform stability tests under their specific laboratory conditions to determine optimal storage parameters.

What expression systems are effective for producing functional DDB_G0273707/DDB_G0273361?

The available recombinant DDB_G0273707 is produced in E. coli expression systems . This bacterial expression platform provides advantages in terms of yield and cost-effectiveness for research purposes. When expressing this transmembrane protein in E. coli, researchers should implement the following methodology:

  • Optimize codon usage for bacterial expression

  • Use specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Employ lower induction temperatures (16-20°C) to facilitate proper membrane protein folding

  • Include appropriate detergents during cell lysis and purification steps

For certain functional studies, researchers might consider alternative expression systems such as insect cells or yeast, which may provide more eukaryotic-like post-translational modifications.

What experimental design considerations are important when studying DDB_G0273707/DDB_G0273361?

When designing experiments involving DDB_G0273707, researchers should follow a systematic approach as outlined in experimental design principles . The following methodology is recommended:

  • Clearly define research questions about DDB_G0273707 function or structure

  • Develop specific hypotheses regarding the protein's role in Dictyostelium cellular processes

  • Identify and control variables that might affect protein behavior

  • Determine appropriate experimental and control groups

  • Calculate necessary sample sizes to achieve statistical significance

  • Implement randomization where applicable to reduce bias

  • Conduct appropriate statistical analyses based on experimental outcomes

Since Dictyostelium proteins have unique properties regarding aggregation resistance , experimental designs should account for this characteristic when comparing results to homologous proteins from other organisms.

How can researchers effectively analyze protein-protein interactions involving DDB_G0273707/DDB_G0273361?

To investigate protein-protein interactions involving DDB_G0273707, researchers should employ a multi-method approach:

What approaches can be used to investigate DDB_G0273707/DDB_G0273361's resistance to aggregation?

Dictyostelium proteins, including transmembrane proteins like DDB_G0273707, demonstrate remarkable resistance to aggregation compared to homologous proteins in other organisms . To investigate this property, researchers can implement the following methodological approach:

  • Comparative solubility assays: Express DDB_G0273707 and homologous proteins from other species in parallel systems, then compare their solubility profiles under various stress conditions.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can assess protein mobility and aggregation state in living cells. In Dictyostelium, proteins typically show high recovery rates indicating solubility, while in aged cultures, some proteins may form insoluble aggregates with no FRAP recovery .

  • Filter trap analysis: This biochemical approach can detect protein aggregates by trapping them on cellulose acetate membranes while allowing soluble proteins to pass through. Dictyostelium proteins typically remain in the soluble fraction under conditions where homologous proteins from other organisms form detectable aggregates .

  • Differential centrifugation: Sequential centrifugation steps can separate proteins based on their solubility properties, with insoluble aggregates pelleting at lower centrifugal forces compared to soluble proteins.

The absence of α-polyQ-reactive bands in insoluble fractions from Dictyostelium, even when expressing aggregation-prone proteins, suggests cellular mechanisms that suppress aggregation . These mechanisms might involve specific chaperones or other factors that could potentially be co-opted for therapeutic applications in human diseases involving protein aggregation.

What genomic approaches can be used to study DDB_G0273707/DDB_G0273361 function?

Advanced genomic methodologies for investigating DDB_G0273707 function include:

  • CRISPR-Cas9 gene editing: Generate knockout or knockin mutations in the DDB_G0273707 gene to study loss-of-function or modified protein variants. The methodology should include:

    • Design of guide RNAs specific to DDB_G0273707

    • Preparation of repair templates for precise modifications

    • Screening of edited clones using sequencing and functional assays

    • Phenotypic characterization of mutant strains

  • RNA-Seq analysis: Compare transcriptomes between wild-type and DDB_G0273707-mutant Dictyostelium to identify downstream genes affected by this transmembrane protein.

  • ChIP-Seq or similar approaches: If DDB_G0273707 influences gene expression, chromatin immunoprecipitation followed by sequencing can identify affected genomic regions.

  • De novo mutation analysis: Similar to approaches used in studies of developmental disorders , analyzing spontaneous mutations in DDB_G0273707 across Dictyostelium populations can provide insights into functionally critical residues.

These genomic approaches should be integrated with phenotypic and biochemical analyses to provide a comprehensive understanding of DDB_G0273707 function.

How should researchers address conflicting data when studying DDB_G0273707/DDB_G0273361?

When encountering contradictory results regarding DDB_G0273707 function or properties, researchers should implement a systematic troubleshooting approach:

  • Validate reagents: Confirm antibody specificity, protein expression levels, and genetic modifications using multiple methods.

  • Assess experimental conditions: Determine whether differences in buffer composition, temperature, cell density, or other parameters might explain divergent results.

  • Consider cellular context: DDB_G0273707 may function differently depending on Dictyostelium's developmental stage or environmental conditions.

  • Evaluate genetic background effects: Different Dictyostelium strains may show variable phenotypes when DDB_G0273707 is manipulated.

  • Age-dependent effects: As observed with protein aggregation studies in Dictyostelium, some phenotypes may only become apparent in aged cultures . Researchers should systematically test for time-dependent changes in protein behavior.

  • Statistical reassessment: Apply appropriate statistical tests and consider whether sample sizes provide sufficient power to detect biologically relevant effects.

  • Seek independent validation: Collaborate with other laboratories to independently replicate critical experiments using standardized protocols.

What bioinformatic tools are most appropriate for analyzing DDB_G0273707/DDB_G0273361 structure and function?

Researchers studying DDB_G0273707 should utilize a suite of bioinformatic tools for comprehensive analysis:

  • Transmembrane topology prediction: Tools such as TMHMM, Phobius, or TOPCONS can predict the arrangement of transmembrane helices within DDB_G0273707.

  • Homology modeling: When crystal structures are unavailable, homology modeling against related proteins with known structures can provide insights into DDB_G0273707 structure.

  • Molecular dynamics simulations: These can predict how the protein behaves in membrane environments and how mutations might affect its stability.

  • Functional domain prediction: Tools like InterProScan can identify conserved domains that might suggest functional roles.

  • Evolutionary analysis: Methods such as positive selection analysis can identify residues under evolutionary pressure, suggesting functional importance.

  • Network analysis: Integration of protein-protein interaction data, co-expression patterns, and genetic interaction networks can place DDB_G0273707 within broader cellular pathways.

  • Variant effect prediction: Tools that evaluate the potential impact of amino acid substitutions can guide mutagenesis studies to identify critical functional residues.

The integration of these computational approaches with experimental data is essential for generating robust hypotheses about DDB_G0273707 function.

How does DDB_G0273707/DDB_G0273361 compare to homologous proteins in other organisms?

Comparative analysis between DDB_G0273707 and its homologs in other species provides valuable evolutionary and functional insights. The transmembrane protein appears to be homologous to transmembrane protein 33 (tmem33) based on sequence similarity . Researchers should conduct the following analyses:

  • Sequence alignment: Multiple sequence alignment of DDB_G0273707 with homologs from various species can identify conserved residues likely crucial for function.

  • Phylogenetic analysis: Constructing phylogenetic trees can reveal evolutionary relationships and potential functional divergence among homologs.

  • Domain architecture comparison: Analysis of domain organization may reveal species-specific adaptations or conserved functional modules.

  • Expression pattern comparison: Examining whether homologs are expressed in similar tissues or developmental stages across species can suggest conserved or divergent functions.

  • Functional complementation studies: Testing whether DDB_G0273707 can rescue phenotypes in organisms with mutations in homologous genes provides direct evidence of functional conservation.

Given Dictyostelium's remarkable protein aggregation resistance properties , special attention should be paid to comparing solubility and aggregation tendencies between DDB_G0273707 and its homologs in systems like yeast, mammalian cells, or other model organisms.

What can we learn from Dictyostelium's protein aggregation resistance in relation to DDB_G0273707/DDB_G0273361?

Dictyostelium discoideum possesses remarkable resistance to protein aggregation that may extend to transmembrane proteins like DDB_G0273707 . This property presents unique research opportunities:

  • Protective mechanism investigation: Researchers can use DDB_G0273707 as a model to study how Dictyostelium prevents aggregation of transmembrane proteins that might aggregate in other systems.

  • Chaperone identification: Co-immunoprecipitation with DDB_G0273707 followed by mass spectrometry might identify Dictyostelium-specific chaperones that prevent protein aggregation.

  • Sequence feature analysis: Comparing the amino acid composition and sequence features of DDB_G0273707 with aggregation-prone homologs might reveal protective sequence elements.

  • Heterologous expression experiments: Expression of DDB_G0273707 in systems prone to protein aggregation could determine whether the protein itself contains intrinsic aggregation-resistant properties or requires the Dictyostelium cellular environment.

  • Aging studies: Since protein aggregation in Dictyostelium becomes more prevalent in aged cultures , studying how DDB_G0273707 behavior changes over time could provide insights into age-related protein homeostasis mechanisms.

These investigations could have implications beyond basic research, potentially informing therapeutic approaches for human diseases involving protein aggregation, such as neurodegenerative disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.