Recombinant Dictyostelium discoideum Uncharacterized FAM18-like protein 1 (DDB_G0276319)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Dictyostelium discoideum Uncharacterized FAM18-like protein 1 (DDB_G0276319) is a protein derived from the slime mold Dictyostelium discoideum . Dictyostelium discoideum is a valuable model organism in cell and developmental biology due to its simple life cycle and ease of use . Recombinant proteins are produced using recombinant DNA technology, involving the insertion of the gene encoding the protein into a host organism (e.g., bacteria, yeast) that can then produce the protein in large quantities .

Production

Recombinant DDB_G0276319 is often produced in host organisms such as E. coli or Yeast . The general steps include:

  1. Gene Cloning: The gene encoding DDB_G0276319 is isolated and cloned into a plasmid vector.

  2. Transformation: The plasmid is introduced into the host organism.

  3. Expression: The host organism is cultured under conditions that induce protein expression.

  4. Purification: The recombinant protein is isolated and purified using various chromatography techniques.

Applications of Dictyostelium discoideum in Research

Dictyostelium discoideum is used as a model organism to study various biological processes :

  • Cell and Developmental Biology: Its simple life cycle makes it ideal for studying cell differentiation, chemotaxis, and cell signaling .

  • Drug Discovery: Dictyostelium is a potential source of novel lead compounds for pharmacological and medical research .

  • Protein Expression: Dictyostelium discoideum can be used as a host for the expression of a variety of heterologous recombinant eukaryotic proteins . This organism possesses the complex cellular machinery required for orchestrating post-translational modifications similar to the one observed in higher eukaryotes .

Protein Structure

Proteins have four levels of structural organization 8:

Function Prediction

Since DDB_G0276319 is currently annotated as an uncharacterized protein, predicting its precise function relies on identifying conserved domains and sequence homologies. The "FAM18-like" designation suggests it shares some similarity with the FAM18 protein family, which, in other organisms, may be involved in various cellular processes.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize your request.
Synonyms
DDB_G0276319; Uncharacterized Golgi apparatus membrane protein-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0276319
Target Protein Sequence
MMKYSPFQDEPSSDNNNNGQNSESQPQSNAPKHPISVFFHLFFKIVAVAIFILSSFVNIG FVLTFIIVTLSSAFDFWVTKNVTGRKLVGLRWWNQIKEDGTNNWVFESVQDKSQVNPAES LMFWVPVLAFTAAWFVFSIISLFGLSFLWLVVEIVCFLLAGANLLGYIKCAKDARKKVKG MAQSYIVGTIVNQAINRV
Uniprot No.

Target Background

Database Links
Protein Families
TVP23 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DDB_G0276319 and why is it significant for research?

DDB_G0276319 is an uncharacterized FAM18-like protein 1 expressed in Dictyostelium discoideum, a model organism extensively used to study eukaryotic cell biology. While its precise function remains to be fully characterized, its significance lies in understanding fundamental cellular processes in this important model organism. D. discoideum has been established as a valuable model for studying numerous aspects of eukaryotic cell biology, including cell motility, cell adhesion, macropinocytosis, phagocytosis, host-pathogen interactions, and multicellular development . The NIH (USA) designated Dictyostelium as a non-mammalian model organism for biomedical research in 1999, making proteins like DDB_G0276319 significant targets for understanding basic cellular mechanisms .

What are the fundamental characteristics of DDB_G0276319?

DDB_G0276319 is a 198-amino acid protein from Dictyostelium discoideum with sequence similarity to FAM18-like proteins. The recombinant form is available with a His-tag and has been expressed in E. coli expression systems . The protein sequence spans 1-198 amino acids, representing the full-length protein . While detailed structural information is limited in the current literature, the protein is expected to share some structural features with other FAM18 family proteins, though its specific function and domain organization in D. discoideum remain to be characterized.

How can I obtain DDB_G0276319 for research purposes?

Recombinant DDB_G0276319 can be obtained as a His-tagged full-length protein expressed in E. coli . Based on standard protocols for working with recombinant proteins from D. discoideum, researchers should:

  • Verify the protein's expression system, tag type, and purification method

  • Consider expression conditions that maintain protein solubility and function

  • Assess protein quality through SDS-PAGE analysis, mass spectrometry, and activity assays

  • Store the protein according to manufacturer recommendations, typically at -80°C with stabilizing agents

Alternatively, researchers can generate the protein in-house using:

  • Gene synthesis followed by cloning into a suitable expression vector

  • Transformation into an appropriate E. coli strain

  • Optimized expression conditions (temperature, IPTG concentration, expression time)

  • Purification via His-tag affinity chromatography followed by size exclusion chromatography

What are the optimal methods for detecting DDB_G0276319 in cell studies?

For detecting DDB_G0276319 in cellular studies, researchers can employ several complementary approaches:

Antibody-based detection:
Recombinant antibodies against D. discoideum antigens have been developed to address the limited commercial availability of antibodies for this model organism . For DDB_G0276319:

  • Use anti-His antibodies for detecting the recombinant His-tagged version

  • Consider generating custom antibodies against DDB_G0276319

  • Validate antibody specificity using Western blot, comparing wild-type and knockout cell lines

Mass spectrometry-based detection:
Mass spectrometry has proven to be a robust, sensitive, and rapid analytical method for protein identification in D. discoideum . The protocol involves:

  • Cell collection (~10^6 cells) and washing in PBM buffer

  • Lysis in RIPA buffer with protease/phosphatase inhibitors

  • Sonication and centrifugation to clarify the lysate

  • Protein quantification using Bradford assay

  • Sample preparation for mass spectrometry (typically 10 μg of protein)

  • Analysis by LC-MS/MS, with services available at core facilities such as those at UT Southwestern or Texas A&M University

What expression systems are optimal for studying DDB_G0276319 function?

Based on research practices with D. discoideum proteins, the following expression systems are recommended:

Bacterial expression (E. coli):

  • Appropriate for biochemical and structural studies

  • Typically uses BL21(DE3) or Rosetta strains

  • Fusion partners like MBP or SUMO can improve solubility

  • Use lower temperatures (16-18°C) and reduced IPTG concentrations for induction

Native expression in D. discoideum:

  • Most physiologically relevant system

  • Enables study of protein in its natural cellular context

  • Methods include:

    • Knockin of tagged versions using CRISPR-Cas9

    • Expression under native or inducible promoters

    • Use of extrachromosomal vectors for transient expression

Mammalian cell expression:

  • Useful for studying interactions with mammalian proteins

  • HEK293 or CHO cells typically used

  • Enables analysis of post-translational modifications

How can I design experiments to study potential protein interactions of DDB_G0276319?

Based on standard approaches for studying protein interactions in D. discoideum:

Co-immunoprecipitation (Co-IP):

  • Express tagged DDB_G0276319 in D. discoideum cells

  • Lyse cells under non-denaturing conditions

  • Perform pull-down with appropriate antibodies or affinity matrices

  • Analyze interacting partners by mass spectrometry

Proximity labeling approaches:

  • Generate fusion constructs of DDB_G0276319 with BioID or APEX2

  • Express in D. discoideum cells

  • Induce proximity labeling

  • Purify biotinylated proteins and identify by mass spectrometry

Yeast two-hybrid screening:

  • Clone DDB_G0276319 into appropriate bait vectors

  • Screen against D. discoideum cDNA library

  • Validate positive interactions with secondary assays

How can I assess the role of DDB_G0276319 in extracellular vesicle biology?

Dictyostelium has been established as an outstanding eukaryotic model for studying mammalian extracellular vesicles (EVs) . To investigate potential roles of DDB_G0276319 in EV biology:

EV isolation and characterization:

  • Culture D. discoideum cells in defined medium

  • Collect conditioned media at different time points (e.g., t8 and t22 as described in the literature)

  • Isolate EVs using differential ultracentrifugation or size exclusion chromatography

  • Characterize EVs using:

    • Electron microscopy for morphology

    • Nanoparticle tracking analysis for size distribution

    • Western blotting for marker proteins

    • Raman Tweezers Microspectroscopy (RTM) as described for D. discoideum EVs

DDB_G0276319 localization in EVs:

  • Generate cells expressing tagged DDB_G0276319

  • Isolate EVs from these cells

  • Assess protein presence in EV fractions by Western blotting

  • Compare with established EV markers

Functional studies:

  • Create DDB_G0276319 knockout cell lines

  • Compare EV production, content, and function between wild-type and knockout cells

  • Assess impacts on recipient cell biology using conditioned media experiments

What are the optimal approaches for studying DDB_G0276319 in the context of protein quality control pathways?

Given that protein quality control pathways are important in preventing protein aggregation in D. discoideum , researchers can investigate DDB_G0276319's relationship to these pathways:

Stress response experiments:

  • Subject D. discoideum cells to various stressors (heat shock, oxidative stress)

  • Monitor DDB_G0276319 expression, localization, and post-translational modifications

  • Compare with known chaperone proteins and quality control markers

Proteasome and autophagy interactions:

  • Treat cells with proteasome inhibitors (e.g., MG132) or autophagy modulators

  • Monitor DDB_G0276319 stability and turnover

  • Assess co-localization with proteasome components or autophagic markers

  • Note that polyphosphate has been shown to decrease levels of proteasome proteins and inhibit proteasome activity in D. discoideum

Protein aggregation studies:

  • Express aggregation-prone model proteins in cells

  • Assess if DDB_G0276319 co-localizes with aggregates

  • Determine if DDB_G0276319 overexpression or knockout affects aggregate formation

How can advanced proteomic approaches be used to characterize DDB_G0276319 function?

Based on established proteomic methods for D. discoideum research :

Quantitative proteomics:

  • Compare proteome changes in DDB_G0276319 knockout vs. wild-type cells

  • Use SILAC, TMT, or label-free quantification approaches

  • Focus analysis on:

    • Protein interaction networks

    • Pathway enrichment

    • Post-translational modifications

Phosphoproteomics:

  • Enrich for phosphopeptides using TiO2 or IMAC

  • Compare phosphorylation profiles between wild-type and DDB_G0276319-modified cells

  • Identify signaling pathways potentially affected by DDB_G0276319

Spatial proteomics:

  • Perform subcellular fractionation of D. discoideum cells

  • Analyze protein distribution across fractions

  • Determine DDB_G0276319 localization and co-fractionating proteins

What bioinformatic approaches can help predict the function of DDB_G0276319?

For this uncharacterized protein, computational analysis can provide valuable insights:

Sequence analysis:

  • Perform multiple sequence alignment with FAM18-like proteins from other species

  • Identify conserved domains and motifs

  • Use tools like BLAST, Pfam, InterPro, and SMART

Structural predictions:

  • Generate 3D structure predictions using AlphaFold2 or RoseTTAFold

  • Analyze potential binding sites and functional domains

  • Compare with structures of characterized FAM18 family proteins

Gene expression analysis:

  • Examine transcriptomic data across different D. discoideum life cycle stages

  • Identify co-expressed genes for potential functional associations

  • Compare expression patterns with genes of known function

How should I interpret contradictory results when studying DDB_G0276319?

When facing conflicting data:

Methodological evaluation:

  • Compare experimental conditions, including:

    • Cell growth conditions (axenic medium vs. bacterial growth)

    • Developmental stage of D. discoideum (unicellular vs. multicellular phases)

    • Protein expression systems (bacterial vs. native)

    • Detection methods (antibody-based vs. mass spectrometry)

Protein context considerations:

  • Assess if contradictions may be due to:

    • Post-translational modifications

    • Protein-protein interactions

    • Subcellular localization differences

    • Strain-specific variations in D. discoideum

Validation strategies:

  • Use complementary techniques (e.g., if Western blot and immunofluorescence give different results, add mass spectrometry)

  • Generate multiple cell lines with different tags or expression levels

  • Include appropriate controls for each experiment

  • Consider the impact of tags on protein function and localization

What statistical methods are most appropriate for analyzing DDB_G0276319 research data?

For robust data analysis:

Differential expression analysis:

  • Use appropriate statistical tests based on data distribution (t-test, ANOVA, or non-parametric equivalents)

  • Apply multiple testing correction (FDR, Bonferroni)

  • Set significance thresholds based on field standards (typically p < 0.05 with FDR correction)

Proteomics data analysis:

  • For label-free quantification:

    • Normalize data to account for loading differences

    • Use specialized software like MaxQuant, Perseus, or Skyline

    • Apply appropriate statistical tests for multiple comparisons

Image analysis:

  • For localization or co-localization studies:

    • Use Pearson's or Mander's correlation coefficients

    • Analyze multiple cells (n > 30) from at least three independent experiments

    • Apply appropriate controls for background subtraction

What are common challenges when working with recombinant DDB_G0276319?

Based on experience with similar proteins:

Solubility issues:

  • Optimize expression conditions:

    • Lower induction temperature (16-18°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Shorter induction times (4-8 hours)

  • Add solubility-enhancing agents:

    • 5-10% glycerol

    • 0.1-0.5% Triton X-100

    • Arginine or glutamic acid (50-100 mM)

Protein stability:

  • Store with stabilizing agents:

    • Glycerol (10-20%)

    • Reducing agents (DTT, TCEP)

    • Protease inhibitors

  • Avoid freeze-thaw cycles

  • Aliquot for single use

Functional assays:

  • Consider that function is uncharacterized

  • Design assays based on predicted functions from bioinformatics analysis

  • Test multiple conditions and readouts

How can I troubleshoot expression problems with DDB_G0276319 in D. discoideum?

When facing expression difficulties:

Low expression levels:

  • Optimize codon usage for D. discoideum

  • Try different promoters:

    • Constitutive (actin 15)

    • Inducible (tetracycline-responsive)

    • Native promoter

  • Consider using extrachromosomal vectors for higher copy number

Protein degradation:

  • Use appropriate protease inhibitors in all buffers

  • Monitor protein stability with pulse-chase experiments

  • Consider tags that might enhance stability (GFP, MBP)

Knockout generation challenges:

  • Use CRISPR-Cas9 with multiple guide RNAs

  • Confirm knockouts by:

    • PCR and sequencing

    • Western blotting

    • Phenotypic analysis

What controls are essential when studying DDB_G0276319 function?

To ensure experimental rigor:

Positive controls:

  • Include well-characterized proteins from the same pathway or cellular compartment

  • Use tagged versions of known proteins with similar localization patterns

  • Include positive controls for activity assays based on predicted function

Negative controls:

  • Empty vector controls for expression studies

  • Isotype controls for antibody experiments

  • Scrambled siRNA for knockdown experiments

  • Wild-type cells for knockout studies

Validation controls:

  • Use multiple tags (N-terminal, C-terminal) to confirm localization

  • Perform rescue experiments in knockout cell lines

  • Use orthogonal methods to confirm interactions or localizations

What are promising research avenues for understanding DDB_G0276319 function in development?

Considering Dictyostelium's unique developmental cycle:

Developmental expression profiling:

  • Monitor DDB_G0276319 expression throughout the D. discoideum life cycle:

    • Vegetative growth

    • Starvation response

    • Aggregation

    • Multicellular development

  • Generate reporter constructs to visualize expression patterns

  • Compare with known developmental regulators

Developmental phenotype analysis:

  • Study developmental progression in DDB_G0276319 knockout cells

  • Assess cell-type specific markers during development

  • Examine cell-cell signaling and adhesion properties

Chimeric development:

  • Mix GFP-labeled knockout cells with unlabeled wild-type cells

  • Track cell fate and behavior during development

  • Assess if DDB_G0276319 affects cell sorting or differentiation

How might DDB_G0276319 relate to host-pathogen interactions studied in D. discoideum?

D. discoideum is an established model for studying host-pathogen interactions :

Phagocytosis studies:

  • Assess if DDB_G0276319 affects phagocytosis of bacteria by:

    • Quantifying uptake of fluorescent bacteria

    • Measuring phagosome maturation kinetics

    • Analyzing lysosomal fusion events

Bacterial infection models:

  • Challenge wild-type and DDB_G0276319 knockout cells with bacterial pathogens:

    • Legionella pneumophila

    • Mycobacterium species

    • Pseudomonas aeruginosa

  • Assess intracellular bacterial growth

  • Analyze cell survival and immune responses

Comparative analysis:

  • Compare findings with mammalian infection models

  • Identify conserved molecular mechanisms

  • Assess potential as a therapeutic target

What novel technologies could advance our understanding of DDB_G0276319?

Emerging technologies with potential applications:

CRISPR screening approaches:

  • Develop genome-wide CRISPR screens in D. discoideum

  • Identify genetic interactions with DDB_G0276319

  • Discover synthetic lethal relationships

Advanced imaging techniques:

  • Apply super-resolution microscopy (STORM, PALM, SIM) to study:

    • Precise subcellular localization

    • Dynamic behavior during cellular processes

    • Co-localization with potential interaction partners

  • Use live-cell imaging to track protein dynamics

Single-cell technologies:

  • Apply single-cell RNA-seq to:

    • Identify cell populations affected by DDB_G0276319 knockout

    • Map gene regulatory networks

  • Develop spatial transcriptomics for developmental studies

How does DDB_G0276319 compare to FAM18-like proteins in other organisms?

While specific data on DDB_G0276319 homologs is limited in the provided search results, a comparative analysis approach would include:

Evolutionary conservation:

  • Identify homologs across species using sequence similarity searches

  • Construct phylogenetic trees to understand evolutionary relationships

  • Compare domain organization and conserved motifs

Functional comparison:

  • Review literature on characterized FAM18 family proteins

  • Compare cellular localizations and proposed functions

  • Identify conserved interacting partners

Model organism studies:

  • Examine phenotypes of homolog knockouts in:

    • Yeast (S. cerevisiae, S. pombe)

    • C. elegans

    • Drosophila

    • Mammalian cell lines

  • Compare with DDB_G0276319 knockout phenotypes in D. discoideum

What can we learn from studying DDB_G0276319 in the context of protein quality control across species?

Building on research about protein quality control in D. discoideum :

Comparative chaperone interactions:

  • Identify if DDB_G0276319 interacts with molecular chaperones

  • Compare with chaperone interactions of homologs in other organisms

  • Assess conservation of quality control mechanisms

Aggregation prevention:

  • Test if DDB_G0276319 prevents aggregation of model substrates

  • Compare with anti-aggregation properties of homologs

  • Assess if function is conserved across evolution

Disease relevance:

  • Determine if human homologs are associated with protein misfolding diseases

  • Use D. discoideum as a model to study these disease mechanisms

  • Test potential therapeutic approaches in this model system

What is the recommended workflow for a researcher new to studying DDB_G0276319?

For researchers beginning work with this protein:

Initial characterization:

  • Expression and localization studies:

    • Generate tagged constructs (GFP, mCherry)

    • Express in D. discoideum

    • Determine subcellular localization

    • Monitor during growth and development

Functional analysis:

  • Generate knockout cell lines

  • Perform phenotypic characterization:

    • Growth in axenic medium

    • Development on bacterial lawns

    • Response to various stressors

  • Perform rescue experiments with wild-type and mutant versions

Interaction studies:

  • Identify binding partners by:

    • Co-immunoprecipitation

    • Proximity labeling

    • Yeast two-hybrid screening

  • Validate interactions with reciprocal experiments

  • Perform domain mapping to identify interaction regions

How should researchers design experiments to resolve conflicting hypotheses about DDB_G0276319?

When facing competing hypotheses:

Systematic approach:

  • Break down each hypothesis into testable predictions

  • Design experiments that directly test these specific predictions

  • Ensure methods can distinguish between alternative outcomes

Multiple methodologies:

  • Apply complementary techniques to address the same question

  • Use both in vitro and in vivo approaches

  • Combine genetic, biochemical, and cell biological methods

Collaborative validation:

  • Consider independent validation by collaborating laboratories

  • Use different experimental systems where appropriate

  • Compare results with different D. discoideum strains

What resources and collaborations are most valuable for DDB_G0276319 research?

Key resources for D. discoideum research:

Community resources:

  • dictyBase (http://dictybase.org) - genomic and proteomic database

  • Dicty Stock Center - strains and plasmids

  • Proteomics core facilities experienced with D. discoideum samples

Experimental support:

  • Mass spectrometry services:

    • University of Texas Southwestern Proteomics Core

    • Texas A&M University Chemistry MS facility

  • Advanced microscopy facilities

  • Structural biology resources (X-ray crystallography, cryo-EM)

Collaborative opportunities:

  • Connect with established D. discoideum research groups

  • Engage with protein quality control experts

  • Partner with computational biologists for advanced data analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.