Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0276837 (DDB_G0276837)

Shipped with Ice Packs
In Stock
Cat. No.
BT2036319
Source
in vitro E.coli expression system
Synonyms
DDB_G0276837; Uncharacterized protein DDB_G0276837
Quick Inquiry

Description

Overview

Recombinant Dictyostelium discoideum Uncharacterized Protein DDB_G0276837 (DDB_G0276837) is a bioengineered protein derived from the social amoeba Dictyostelium discoideum. It is expressed in E. coli with a His-tag for purification and is classified as a full-length uncharacterized protein (1–72 amino acids) . While its biological function remains unknown, it is part of a broader family of uncharacterized proteins in D. discoideum, a model organism for studying cellular processes such as phagocytosis, chemotaxis, and DNA repair .

Gene Information

PropertyValue
Gene IDDDB_G0276837, DDBDRAFT_0168993, DDB_0168993
UniProt IDQ86L28
SynonymsDDB_G0276837; Uncharacterized protein DDB_G0276837
Expression RegionFull-length (1–72 amino acids)
Amino Acid SequenceMSQNNLKFTEFLSNVKSKANSKGFMKLFDMYHRQVVVKKPFSFLVHIMCGLTLTSYVIRHDKVEHHKTQPYH

Protein Structure

  • Tag: N-terminal His-tag for affinity purification .

  • Molecular Weight: ~8.3 kDa (theoretical) .

  • Purity: >90% as determined by SDS-PAGE .

Production Pipeline

StepDetails
Host OrganismE. coli
Expression VectorpcDNA3.1+/C-(K)DYK or custom vectors
Purification MethodAffinity chromatography (His-tag)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Applications

  • Research Use: Serves as a reference material for studying D. discoideum protein interactions or functional assays .

  • Limitations: No published functional studies or pathway associations .

Functional Speculation

While DDB_G0276837 lacks experimental validation, its classification in D. discoideum suggests potential roles in:

  1. Pathogen Defense: Analogous to bacteriolytic proteins (e.g., BadA, BadB, BadC) with DUF3430 domains .

  2. DNA Repair: Part of a genome with conserved DNA repair pathways (e.g., NHEJ, BER) .

  3. Metabolic Regulation: Given D. discoideum’s role in studying sphingolipid metabolism and chemotherapeutic resistance .

Comparative Analysis

FeatureDDB_G0276837Related Proteins in D. discoideum
DomainUnidentifiedDUF3430 (BadA/B/C), DNA-PKcs (NHEJ)
Expression PatternsVegetative growth (HL5 medium)Starvation-induced (e.g., kil1, kil2)
Purification EfficiencyHigh (>90%)Variable (e.g., BadA requires heat-sensitive steps)

Knowledge Gaps

  • No Functional Data: Unlike bacteriolytic proteins (e.g., BadA, which contributes to K. pneumoniae lysis) , DDB_G0276837 has no documented activity.

  • Evolutionary Context: Limited homology to characterized proteins in other organisms .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

Note: The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize its inclusion.
Synonyms
DDB_G0276837; Uncharacterized protein DDB_G0276837
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-72
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0276837
Target Protein Sequence
MSQNNLKFTEFLSNVKSKANSKGFMKLFDMYHRQVVVKKPFSFLVHIMCGLTLTSYVIRH DKVEHHKTQPYH
Uniprot No.
Q86L28

Target Background

Database Links

KEGG: ddi:DDB_G0276837

STRING: 44689.DDB0168993

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.